KEGG   Echinicola vietnamensis: Echvi_2446Help
Entry
Echvi_2446        CDS       T02388                                 

Definition
pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
evi  Echinicola vietnamensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:evi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Echvi_2446
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Echvi_2446
  Amino acid metabolism
   00310 Lysine degradation
    Echvi_2446
Enzymes [BR:evi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Echvi_2446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2905313..2906596)
Genome map
AA seq 427 aa AA seqDB search
MATVEMVMPKMGESIIEGTILTWLKKEGESIEEDESVLEVATDKVDTEVPSSHAGVLKKI
LAKEGDVVAVGAPIALIETEGEEEDDTKATEPKEVDTDSSSEKEDLLAAAPSQTATIINP
VTEKSTGDKRFYSPLVLSIAKEEGISKAELATIPGTGKEGRVTKHDMLDYLKSRSTATSG
TPMPKAAASVSAGDEIIEMDRMRKMISERMVASKQISPHVTSFVEADVTNIVLWRNKVKE
AYKNKMGEPLTFTPFFVEAVAKAIQDFPMINISVDGDRIIKKKDINIGVAVALPSGNLIV
PVIKKANELNLTGLSKKINDLAARARTNKLAADELSGGTYTISNVGSFGNLMGTPIIMQP
QVAILAVGAITKKPAVMETPTGDVIAVRHKMFLSHSYDHRVVDGSLGGMFVKRVADYLEA
FDIDSKL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgtagaaatggtaatgcccaaaatgggtgagagtattatagagggcaccatc
ttgacatggttaaaaaaagaaggtgaaagcatagaagaggatgagtcggtactggaagta
gctaccgacaaggtagatacggaagtgccttcttcccatgctggtgtattgaaaaaaatc
cttgccaaggaaggtgacgtggtggctgtaggcgcccctattgccctgatagaaacagaa
ggcgaggaggaagatgatactaaagccaccgagccgaaagaagtagatacagacagcagt
agtgaaaaagaagatttattggcggctgctccatcacaaacggccaccatcattaatcca
gtaacagagaagtccactggggacaagcgtttttactcgcctttggtactcagtatcgcc
aaagaagaaggcatctctaaagctgagcttgcgacaattccgggcactggaaaagaaggc
agggtcaccaaacacgacatgctcgattacttaaaatccaggtctaccgctacttccgga
actcctatgcctaaggccgcagcgagtgtttctgccggggatgagatcattgaaatggac
aggatgcgtaaaatgatctccgaaaggatggtcgcttccaaacagatctctccgcacgtc
acttcttttgtagaggctgatgtgacaaacattgtcctttggagaaacaaggtcaaggaa
gcatacaaaaacaagatgggcgaaccccttacctttaccccgttctttgttgaagcagtg
gccaaggctatccaagacttccccatgatcaacatctctgtcgatggtgatcggatcatt
aagaaaaaggacataaacatcggtgtggccgtagcacttcccagcggcaatcttatcgtg
cctgtcatcaagaaagccaatgaactcaaccttacagggctttccaaaaagatcaacgac
ttggctgcaagggcccgaaccaacaaattggccgccgatgagctttcaggtggaacctat
acgatatcgaatgtaggatcatttgggaatcttatgggtactcccatcattatgcagcct
caagtggccattttagcggtaggtgccattaccaaaaagcctgctgtaatggaaacgccg
actggagatgtcattgccgttcggcacaaaatgttcctgtcccactcttatgaccatcga
gtagtagacggttcgctgggcggaatgtttgtcaaaagagtagccgattacctcgaagca
tttgatattgacagcaaattataa

DBGET integrated database retrieval system