KEGG   Echinicola vietnamensis: Echvi_2459Help
Entry
Echvi_2459        CDS       T02388                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
evi  Echinicola vietnamensis
Pathway
evi00340  Histidine metabolism
evi01100  Metabolic pathways
evi01110  Biosynthesis of secondary metabolites
evi01230  Biosynthesis of amino acids
Module
evi_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:evi00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Echvi_2459
Enzymes [BR:evi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Echvi_2459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh Phage_TTP_13 ESM4
Motif
Other DBs
NCBI-ProteinID: AGA78706
UniProt: L0G118
Position
complement(2918979..2920268)
Genome map
AA seq 429 aa AA seqDB search
MRTITNPTQSEWQKELARPVQKMKDIQKIVKPIMRKVSRQGDKALKKFALEYDHVEIDNL
LVSRDEINEAYEQVDESLKSAIQQAKVNIEKFHKAQQTEDLSMEVMEGVTCMRRSVPIQK
VGLYIPGGTAPLFSTVLMLGIPANIAGCEEIVLCTPPNKEGKIHPAILYTANLIGIDKIV
KAGGAQAIAALTYGTESVPQVAKIFGPGNQYVTAAKQLATKKGIAIDMPAGPSEVLVYAD
ESAVPAFVAADLLSQAEHGIDSQVILVATASKVAKKTLKEVDKQLAKLPRKDIAKKALEN
SIAVVMGNQEKAIALINDYAPEHLIINVANEDEVVANIVNAGSVFIGNFTPESAGDYASG
TNHTLPTYGFARNYSGVSLDSFVKKITYQKITEKGLQNLGPTIEVMAGNELLDAHKNAVS
IRLKYLKEK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagaaccataaccaatcccacccaaagtgaatggcaaaaggaactggcccggccagtt
caaaagatgaaggatatccaaaaaatcgtcaagccgatcatgcgcaaagtcagccggcaa
ggggacaaagcgctgaaaaagttcgcattggaatatgatcatgtagaaatcgacaacctt
ctggtgtcacgcgatgagatcaacgaggcatatgagcaggtggatgaatccttaaaatct
gccattcagcaagccaaagtaaatattgagaagttccataaagcccagcaaacggaagac
ctgagcatggaagtcatggaaggggtaacctgcatgcgcagaagcgtgccaatccaaaaa
gtaggcctgtacatccccggtggaacagcgccattattctctaccgtgttgatgctgggc
atccccgccaacattgcaggatgtgaggaaattgtcctttgcaccccaccaaacaaggag
ggaaaaatccatccggccattttatacacggccaacttgatcggtatcgacaaaattgtc
aaagcaggcggcgctcaagccattgctgccctcacctatggcaccgaaagtgttccgcag
gtggccaagatatttggtccgggcaaccaatatgtcactgctgccaagcaactggccacg
aaaaagggaattgccatcgatatgcctgccgggccttccgaggtcttggtatatgccgat
gaatcagcggtaccggcatttgtggccgcagacctgctctctcaagccgagcatggcatc
gacagtcaagtcattttggtcgccaccgcttcaaaagtcgccaaaaaaacacttaaggaa
gtagacaagcaacttgctaaacttccccgaaaggatatcgccaaaaaagcattggaaaac
agcattgctgtagtcatgggcaatcaggaaaaggccattgccctgatcaatgactatgcc
ccggagcacctcatcattaatgtggccaacgaggacgaagtggtggcaaatatcgtcaat
gccggttcagtctttatcggcaacttcaccccggaatcagctggggattatgcctccggc
accaaccacaccttacccacctatgggtttgccagaaattacagcggagtgtcattggat
agctttgtgaaaaaaatcacctatcaaaagattacggaaaaaggccttcaaaacttaggc
cctaccattgaggtgatggcaggaaacgagctccttgacgcacacaaaaacgctgtttcc
atccgtttaaaataccttaaagaaaagtaa

DBGET integrated database retrieval system