KEGG   Echinicola vietnamensis: Echvi_2508Help
Entry
Echvi_2508        CDS       T02388                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
evi  Echinicola vietnamensis
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:evi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Echvi_2508
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Echvi_2508
Enzymes [BR:evi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Echvi_2508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2980232..2981050
Genome map
AA seq 272 aa AA seqDB search
MNILDKIIAHKKEEVAERKSLVPTKMLERSVFFENKVVSMKKYVTLPTKTGIIAEFKRKS
PSKGAINSAAKVEKTSIGYMQAGASALSVLTDKEFFGGSNEDLITARKFNFCPILRKDFI
VDEYQIVEAKSIGADCILLIAAALEPKRLEELAIFAHKLGLEVLMEVHDQEELDRSLNDH
LDLVGVNNRSLKTFEVSLDTSYDLVGQIPDKFVKISESGISDPQTLVDLKKGGFDGFLIG
ENFMKSIRPHQAAYNFMNKYRELSPDFKTETV
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaatatacttgacaaaatcattgcgcacaaaaaggaagaagtagctgagcgaaaaagc
ttggttcccaccaaaatgctcgaaagaagtgtgtttttcgaaaacaaggtggtgtccatg
aaaaaatatgtgacgcttccaaccaaaaccggtatcattgcggaattcaaacggaaatct
ccctctaaaggagccatcaacagtgccgcaaaggtggagaaaaccagcattggctatatg
caggcgggagcttctgcgctgtcggtattgacagacaaggaattctttggtggttccaat
gaagacctgatcaccgcccggaagtttaatttttgtccgatccttcgcaaggactttatt
gtggatgaatatcaaattgtggaagccaaatcgataggggcagattgtatcctattgatt
gctgctgcgcttgagccaaaacgattggaggagctggccatttttgcccataaactgggg
ttagaagtgctgatggaagtgcatgatcaggaggagcttgaccgttctctgaacgatcat
ttggatttggtgggcgtgaacaatagaagcttgaagacctttgaagtgtccctggatact
tcgtatgatttggtcggtcaaattcccgataaatttgtgaagatatctgaaagtggcatt
tctgatcctcagacattggtggatttgaagaagggtggatttgatggttttttgatagga
gaaaactttatgaagtctatccggccgcatcaggctgcttataactttatgaacaaatac
cgggaactgagtccggatttcaaaacagaaacggtttaa

DBGET integrated database retrieval system