KEGG   Echinicola vietnamensis: Echvi_2663Help
Entry
Echvi_2663        CDS       T02388                                 

Definition
beta-1,4-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
evi  Echinicola vietnamensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3159058..3160218
Genome map
AA seq 386 aa AA seqDB search
MTMSRTKRMAGVFQTSIKCLLASALLFSACKGNAQHEENSTLKTAFEDKFAIGTAMNAWQ
ISGRDSAATKIIKDQFSAIVAENCMKSGRLQPEEGEFTFDLADQFVEFGEQNDMLINGHT
LIWHSQAPRWFFTDAEGQDVSREVLIERMKTHIHTVVGRYKGRVDTWDVVNEAILDDGSY
RESKFYQIIGEDFIKLAFQFTHEADPDAELYYNDYSMAEPGKREGVVRMVKKLQAEGVKI
DGIGMQGHIGLHHPEIREFEKSLEAFADLGVEVMVTELDLTVLPSPWDDQGAEVSKNFDY
EDKMNPFPNGLPDEVRDAFDARYLEFFALFLKHQDKISRVTLWGVADQHSWRNGWPIRGR
TDYPLLFDRENKAKPIVEKLIKLTKQ
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgactatgtcgaggactaaacgaatggcaggcgtttttcaaacttccataaagtgcctg
ttggcttctgcgctattgtttagcgcatgcaaaggcaacgcacaacatgaagaaaatagc
accctgaaaaccgcctttgaagataaatttgcaataggcacagccatgaatgcctggcag
atttccggcagggattctgccgccaccaagattattaaagaccagtttagcgctatcgtg
gcggagaactgcatgaagagtggccgcctgcagccagaggaaggggaatttacgtttgac
ctagccgatcagtttgtggaatttggggagcaaaatgatatgctcatcaatggccatacc
ttgatctggcattcccaggcaccaaggtggtttttcacagatgcagaagggcaggacgta
tcacgcgaagtgctgatcgagcggatgaaaacgcatatccataccgtggtcggaaggtac
aagggccgagtggatacctgggatgtagtcaacgaggccatcttggacgatggcagttat
cgggaaagtaagttctaccagattatcggagaggattttatcaaattggcctttcagttt
acccatgaggctgatcctgatgctgagctgtattataatgactattccatggctgagccc
gggaaaagggaaggggtcgttcgcatggtcaaaaagctccaagctgaaggcgtcaagatt
gatgggatcggcatgcaggggcatattggcctgcaccatcctgaaatcagagaatttgaa
aaaagccttgaagcctttgccgatttgggtgtggaagtgatggtcaccgagctggacctt
accgtgcttccttccccttgggatgaccaaggggctgaggtcagcaaaaactttgactat
gaggacaaaatgaatccttttcccaatgggctccccgacgaggtgagggatgcttttgat
gcgcgttacctggagttcttcgctttattccttaagcaccaggacaagatttctagggtt
accctttggggagtggccgaccagcattcctggagaaacggctggccgattcgaggcagg
acagattatcccttgctctttgatcgggaaaataaagcaaaaccaatagtggaaaagctt
ataaaactaaccaagcagtaa

DBGET integrated database retrieval system