KEGG   Echinicola vietnamensis: Echvi_2908Help
Entry
Echvi_2908        CDS       T02388                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
evi  Echinicola vietnamensis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:evi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Echvi_2908
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Echvi_2908
   00640 Propanoate metabolism
    Echvi_2908
   00660 C5-Branched dibasic acid metabolism
    Echvi_2908
Enzymes [BR:evi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Echvi_2908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3483633..3484850)
Genome map
AA seq 405 aa AA seqDB search
MNIHEYQAKEVLKGYGVKIQEGIVAETPEAALEAAKQLNAETGTSWYVIKAQIHAGGRGK
GKIQQTDSNGVVLAKKLDEVPEKAKNILGGTLVTHQTGPEGKNVSKVLVAQDVYYPGDSE
PKEYYLSILLDRAKGCNVIMASTEGGMDIEEVAEKTPEKIIKEWIDPKVGLQGFQARKVA
FALGLSGNALKEMVKFISALYKAYDATDSSQFEINPVLKTSDDQILAVDAKVNLDDNALY
RHRDLAELRDLSEEDPLEVEAGKSDLNYVKLDGNVGCMVNGAGLAMATMDMIKLSGGEPA
NFLDVGGGANATTVEAGFRIILKDPNVKAILINVFGGIVRCDRIASGVVEAYKSIGDIRV
PIIVRLQGTNAEEGAKIIDESGLKVSSAITLKEAAEKVQEVLKNA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaatatacacgaatatcaagcaaaagaagttcttaaaggatacggagtgaaaattcag
gagggcattgtagccgaaacgcctgaagcagcactcgaagcagccaagcaactcaacgca
gaaacaggtacctcatggtatgtgatcaaagcacagatccatgcgggtggacgtggtaaa
ggtaagattcagcaaactgattccaatggtgtggtgttggccaagaagttggatgaagta
cctgaaaaagccaaaaacatcctaggagggactttggtaacacatcaaacaggcccagaa
ggaaaaaacgtaagcaaagttttggtcgcacaggacgtatattatcctggtgattcagag
cctaaagaatattacctatccatccttttggacagggccaagggatgcaatgtcatcatg
gcctctacagaaggtggtatggacatcgaagaggtagccgaaaagactccagaaaagatc
atcaaggaatggatcgatcccaaggtaggactgcaaggtttccaagctagaaaagtagct
tttgcacttggcttgtctggtaatgccctgaaagaaatggtgaaattcatttcagcattg
tacaaagcttatgatgctactgattcatctcaatttgaaatcaacccggttctaaaaact
tcagacgatcagattttggcggtagatgccaaggttaaccttgacgacaacgccctttat
agacaccgagatcttgctgagcttcgtgacctttccgaggaagatcctttggaagtagaa
gcgggcaaatctgacctaaactatgtcaagctggacggtaacgtaggctgtatggtaaac
ggtgctggacttgctatggccactatggacatgatcaagctttccggcggtgagcctgct
aacttcttggacgtaggaggcggagccaatgctaccactgtagaagctgggtttaggatc
atcctaaaagatccaaacgtaaaagccattctgattaatgtttttggtggtatcgttagg
tgtgaccgaatcgctagtggtgtggtagaagcttataaatccatcggtgacattcgtgtc
ccaatcatcgtaagacttcaaggaaccaacgctgaagaaggtgccaaaatcatcgatgaa
tctggactgaaagtttcctctgcaataactttgaaagaagctgcagaaaaagttcaagaa
gtgcttaaaaacgcataa

DBGET integrated database retrieval system