KEGG   Echinicola vietnamensis: Echvi_2915Help
Entry
Echvi_2915        CDS       T02388                                 

Definition
nicotinamidase-like amidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
evi  Echinicola vietnamensis
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:evi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Echvi_2915
Enzymes [BR:evi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Echvi_2915
    3.5.1.-  
     Echvi_2915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3490537..3491154
Genome map
AA seq 205 aa AA seqDB search
MRALLIVDMQNDFLPGGALAVKDGDKVIPVINKLQEKFDFILATQDWHPADHKSFADNHS
GKEPGEVIKLGGTDQMLWPVHCVQDSEGAQFAKDLNRTNWKKIFKKGLNPLVDSYSGFFD
NKKKEDTGLTAYLHAHNISDLYVTGLAADYCVKFTVLDALKEGFDTYLIADATRAVNLSP
DDYDESLKEMSKSGAEVITSAAISF
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcattattgattgtggatatgcagaatgattttttacctggaggagcgctagcg
gtaaaggatggcgataaggtcatcccggtgatcaacaaacttcaggaaaagtttgatttt
attttggctactcaagattggcatcctgctgatcacaaaagttttgcggataatcattca
ggtaaagaacccggtgaggtcataaaactgggcgggacagatcaaatgctctggcctgtt
cattgtgtgcaggacagtgaaggggcccagtttgcaaaagacctaaaccgcacaaattgg
aaaaaaatattcaaaaagggccttaacccgcttgtagattcctatagtggctttttcgat
aataaaaaaaaggaagatactggattgaccgcttatttgcatgcgcataatatttcggat
ttgtatgttacaggattggcagcagattattgtgttaagttcacggtgctggatgcgttg
aaagaagggtttgacacctatttgatcgctgatgctaccagggctgttaacctatctccg
gatgattatgatgagtcacttaaagaaatgagcaagtccggtgcagaagtcattaccagc
gcagcgatctctttttga

DBGET integrated database retrieval system