KEGG   Echinicola vietnamensis: Echvi_3166Help
Entry
Echvi_3166        CDS       T02388                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
evi  Echinicola vietnamensis
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:evi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Echvi_3166
Enzymes [BR:evi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Echvi_3166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3772151..3773653
Genome map
AA seq 500 aa AA seqDB search
MDTHSNILKYKHLGIYTQNENVVYMREDCHVCISEGFEALTRIRISNANTSIVASLNVLN
SDILLPNEIGLSDAAAKKLNVSQNDTLYVSHLEPIESLSHVRAKIYNKKLDYKAYNNIIT
DIVEGDYSNIHLSAFITACAGDRMDIDEISDLTKAMIASGKQLNWNKDIVVDKHCIGGLP
GNRTTPLVVAIVAAYGLTMPKTSSRAITSPAGTADTMEVLTNVTLSSEEIKTVVEKEGGC
FVWGGTAQLSPADDVLIKIEKALDIDSEGQLIASVLSKKAAAGSTHVVIDIPVGETAKVR
STEMAEKLKNHMETVGTAVGLNVKVVVTDGTQPVGRGIGPTLEAIDILKVLKNEEDAPKD
LTERALLLATELLELSGKVEKGKGLETAHKILKSGKAYEKFIAICKAQGQFSKPVLAPYK
IEIKAEKSGVLQRIDNRKIAKLAKLSGAPQSKSAGILLNVHLNEKIEIDQLLYTIYAESK
GELNYALEYKNNHNDIITII
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggacacacactcaaacatattaaaatacaaacacctcggcatctatacccaaaacgag
aatgtagtgtatatgcgcgaagattgccacgtttgtatttcagaagggtttgaggcactt
acccgaataagaatatccaatgcaaatacatcaatcgtggcaagtcttaatgttttgaat
tctgatatcttgttgcccaatgaaatcggactatcagatgctgctgcgaaaaaactcaat
gtgtcccaaaacgatacattgtatgtttcccatttagaacctatagaatcgttaagccac
gtcagggcaaaaatctataacaaaaaactggattataaggcctataacaacatcataacc
gatatcgttgaaggcgattattccaacatccatctttcggcatttattactgcctgtgct
ggcgaccgaatggatattgatgaaataagtgaccttactaaagcaatgattgcttccgga
aagcaactgaactggaacaaggatatcgtggtcgacaaacattgtattggtggtttacca
ggcaatagaacaaccccattggtagtagccattgttgccgcgtatgggcttactatgcca
aaaacatcctcacgggcaatcacttcaccagcaggcacagcagatacaatggaagtactg
accaatgttacgctctcttccgaggaaataaagaccgtagtagaaaaagaaggcggatgt
tttgtttggggcggtacagcgcagttaagtcctgccgatgatgtgctcattaaaattgaa
aaagccttggatattgatagcgaaggtcagctcattgcttcagtactctctaaaaaggca
gcagctggttctactcacgtggtcattgatattcccgtgggagaaaccgccaaggttcgc
agtaccgaaatggcagaaaaactaaaaaatcatatggaaactgttggaactgctgttggg
ttgaatgtaaaagttgtagttacggatggcactcagccggttggaaggggtatcggtcca
acattagaagccatagatatattaaaagttttgaaaaatgaggaagatgcacctaaagac
ttaacagaaagagcgttgcttttagctactgaactattagaactttctggaaaagtagaa
aaagggaagggactggaaaccgcacataaaattctcaaatctggaaaagcatatgaaaaa
ttcatagccatttgtaaggcgcaaggtcaattttcaaaaccagttttagcaccttataaa
attgaaattaaagctgaaaagtcaggcgttttgcaacgaattgataaccgaaaaatcgca
aaacttgccaagctttctggagcaccacaatctaaatcggcagggattcttttgaatgtc
catttaaatgaaaaaattgaaatagaccaattgttatataccatatatgctgaatccaaa
ggcgaactcaactatgctctggaatataaaaacaaccataatgacatcataactataatt
taa

DBGET integrated database retrieval system