KEGG   Echinicola vietnamensis: Echvi_3219Help
Entry
Echvi_3219        CDS       T02388                                 

Definition
Zn-dependent alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
evi  Echinicola vietnamensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:evi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Echvi_3219
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Echvi_3219
  Lipid metabolism
   00071 Fatty acid degradation
    Echvi_3219
  Amino acid metabolism
   00350 Tyrosine metabolism
    Echvi_3219
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Echvi_3219
   00626 Naphthalene degradation
    Echvi_3219
Enzymes [BR:evi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Echvi_3219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3820366..3821397)
Genome map
AA seq 343 aa AA seqDB search
MLPKTMKAAVVTEFGQPLKIEEIPVKAPNENQILVQVMASGVCHTDLHAADGDWPVKPRL
PLIPGHEGIGYVAAVGSNVKNTKEGDIVGVPWLYSACGHCEHCITGWETLCESQVNGGYS
VDGGYAEYVLADPNYVGRFSGAIDFVQMAPILCAGVTVYKGLKETEVRPGQWVAISGIGG
LGHVAVQYAKAMGLHVLAVDVSDDKLNLAKKLGADRVVNGKNPDEVMNARKETGGVHGVL
VTAVSPVAFRQALDLLRRKGTLVMNGLPPGSFDLPIFETVLNRYTVRGSIVGTRKDLQEA
IDFAMEGKVTTTVKSAPLEDINLIFDQMKKGQIEGRMVLDIGH
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgttaccaaaaaccatgaaagcggctgtggtcacagagtttggccaaccgcttaaaatt
gaagagatacctgtaaaggccccaaatgaaaaccaaatcctggtgcaggtaatggcatca
ggagtatgccatacggatttgcatgcagctgatggcgactggcctgtcaagcccaggttg
ccgctcattcctggccatgaaggcattggctatgtggcggctgtgggctccaatgtaaaa
aacaccaaagaaggtgatatagtgggtgttccctggctctacagtgcctgcggtcattgc
gagcattgcattacaggttgggaaacactgtgcgagtcgcaggtaaacggaggctacagc
gtagatggcggctatgcggaatacgtattggcagatcccaattatgtagggcggttcagc
ggagccatagactttgtgcaaatggcccctattttatgtgcgggtgtaacggtgtataaa
ggcctaaaagaaaccgaagtgcgaccaggacagtgggtggccatttcaggcataggtggc
ctgggtcatgtggcagtgcaatacgcaaaagccatgggtttgcatgtgcttgcagtggat
gtgtcagatgacaaattgaacctggccaaaaagcttggagctgatagagtggtcaacggt
aaaaatcccgatgaagtgatgaatgcccggaaagaaacgggtggtgttcatggcgtgttg
gtcacggctgtgtcaccggtggctttccggcaggcactggacctgctacgcagaaaagga
acgttggtaatgaatggacttcctccaggtagctttgacctgcccatttttgaaaccgta
ttgaatcgctatacggtgcgtggctccattgttggcaccaggaaagacctgcaggaagct
atcgactttgcaatggaaggaaaggtaaccaccacggtaaaatccgctccgctggaggat
atcaacctaatctttgatcaaatgaaaaagggacagatagaaggccgtatggtgctggat
attggtcattaa

DBGET integrated database retrieval system