KEGG   Echinicola vietnamensis: Echvi_3311Help
Entry
Echvi_3311        CDS       T02388                                 

Definition
(GenBank) transcriptional regulator/sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
evi  Echinicola vietnamensis
Pathway
evi00010  Glycolysis / Gluconeogenesis
evi00052  Galactose metabolism
evi00500  Starch and sucrose metabolism
evi00520  Amino sugar and nucleotide sugar metabolism
evi00521  Streptomycin biosynthesis
evi01100  Metabolic pathways
evi01110  Biosynthesis of secondary metabolites
evi01120  Microbial metabolism in diverse environments
evi01130  Biosynthesis of antibiotics
evi01200  Carbon metabolism
Module
evi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:evi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Echvi_3311
   00052 Galactose metabolism
    Echvi_3311
   00500 Starch and sucrose metabolism
    Echvi_3311
   00520 Amino sugar and nucleotide sugar metabolism
    Echvi_3311
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Echvi_3311
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Echvi_3311
Enzymes [BR:evi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Echvi_3311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Pan_kinase
Motif
Other DBs
NCBI-ProteinID: AGA79534
UniProt: L0G051
Position
3913058..3913975
Genome map
AA seq 305 aa AA seqDB search
MNNQNEHFLGVDVGGTHLKIGKVSQQGEIVSFDKEDTSHYKEDPKGFNTCFVDVIGKYLS
KYPDINKVGIGLPGLINKERTTTLEIPAIPELNGFDLKGALLEKYPEKSFFLENDASAAA
MGEYKFASSRPSANFLFITMGTGIGSAAVVEGAIFKGARGNAMEMGHMLSRGNARLETII
GRKGILSIMKRMIDAYPEKAGVLLEKELGTHLLVDTAKEGNEVSLMTFEEVGDILGEAIV
STIRVLDINEVYFGGGISAGLEFMMPSLEKTVRQYLTHYYTDDLQLKKATLGNNAGTQGA
AALCF
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaataatcaaaacgagcactttttgggtgtagacgtcggtggaacccacctaaaaatt
ggtaaagtaagccagcaaggagaaattgtgtcatttgataaagaagataccagtcattac
aaggaagaccccaaaggtttcaatacttgttttgtggatgtcattgggaaatacctatca
aaataccccgatatcaataaagtaggcattggcctgccgggcttgatcaacaaggagcgg
acgaccactttggagataccggccattcctgaattgaatggctttgacctgaagggggcg
ctgttggaaaaatatcccgagaagagtttctttctggaaaatgatgccagtgctgcggcc
atgggggagtataaatttgcgtcttccaggccatctgccaatttcctgtttatcaccatg
ggaacaggcattggtagtgccgcggtagtggaaggggcgatttttaaaggagcccgtggc
aatgccatggagatggggcatatgctctcccgcggcaatgcacgcttagaaaccatcatc
ggcaggaaaggcatcttgagtatcatgaaaaggatgatcgatgcctatcctgaaaaagca
ggggtgttactggaaaaggaattagggacccacttattggtagatacagctaaggaggga
aatgaagtttcattgatgactttcgaggaagtgggggacatccttggcgaggccatcgtt
tccacgatccgtgttttagacattaatgaagtttatttcggaggaggaatatctgcagga
ttggagtttatgatgccttccctggaaaagaccgtaaggcaatacctgacccattattac
accgatgacctccagttgaaaaaggcaacattgggcaataatgccggtacccaaggtgcg
gcggcattgtgcttttag

DBGET integrated database retrieval system