KEGG   Echinicola vietnamensis: Echvi_3721Help
Entry
Echvi_3721        CDS       T02388                                 

Definition
protein-L-isoaspartate and D-aspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
evi  Echinicola vietnamensis
Brite
Enzymes [BR:evi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Echvi_3721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4427070..4427723
Genome map
AA seq 217 aa AA seqDB search
MIKLEDSYSHKGQRKALVKTLERKGIMDKKVLEAIATIPRHFFFDSALHSHAYEDKAFPI
GEGQTISQPFTVAFQSELLALKPGDKVLEIGTGSGYQAAILYLLGAEVHTIEYNQHLYQR
TKKFLPKLGIKAHFYQGDGSMGIPEKAPFDKIIVTAGAPIVPKSLLKQLKVGGILVIPVG
DRKTQKMMKLTKKTAKQITQEEYDSFAFVPLLGNEGW
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgataaaattggaggatagctattctcataaaggccagcgaaaggcactggtaaagaca
ctggaaagaaagggcattatggacaaaaaagtactggaagccattgccacgattccccgg
catttcttctttgacagcgccttgcacagccatgcctatgaggacaaagccttccccatc
ggcgaaggtcagaccatctcccaaccttttaccgtggcctttcaaagtgagctcttggcc
ttgaagcccggtgacaaagtcctggaaatcggcaccggatctggttatcaagcggccatt
ctctacctactgggcgcagaggtacacaccatcgagtacaaccagcacctgtatcaacgg
accaaaaagtttcttccaaaactggggatcaaagcacacttctaccaaggagatggctcc
atgggcattcccgaaaaggctccctttgataagatcatcgtcactgccggggcccccatc
gtgccgaaaagcctgttgaaacaattaaaagtaggcggcattttggtgatccctgtaggg
gaccgtaaaacccaaaagatgatgaagctgaccaaaaagaccgccaagcaaataacccaa
gaggaatacgatagctttgcttttgtgccactgctgggcaatgaaggatggtaa

DBGET integrated database retrieval system