KEGG   Echinicola vietnamensis: Echvi_4021Help
Entry
Echvi_4021        CDS       T02388                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
evi  Echinicola vietnamensis
Brite
Enzymes [BR:evi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Echvi_4021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4815556..4816680
Genome map
AA seq 374 aa AA seqDB search
MRYQAPCFMGTVLLCLLMWACSKEEPEEPSTPNPVITLEHPEYFPNDVPMPANNPLTEEG
VALGRMLFYEKQLSIDGTMACASCHQQAKAFTDGKKISTGVNGTPGDKNAMSLANLHWTS
RFFWDGRAASLEEQALQPIEDHREMNLPIAEAVARLQADENYPERFEKAFGSNQITETMI
GKALAQFMRTLISGDSRFDQWIRGEVEFTEQEQLGMELFFTHPEPSLHIRGGNCGDCHLG
FLTSGDRNNLLGFHNNGLDQDAYLEEGLAAVTGLPKDKGKFKAPTLRNIALTAPYMHDGR
FETLTEVLEHYDEHIQMNSTLDILILEASNETIAPGENIKLYLTDGEKEAILSFLHTLTD
EKFITNPKFSDPFN
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgcgataccaagccccatgttttatgggaacagtactcttgtgcttgctgatgtgggcc
tgtagcaaggaagagcccgaagagccttctacgccaaacccagtgatcaccttggagcat
cccgagtacttccccaatgatgtgcccatgccggccaataatccgttgaccgaagagggt
gtggcactcggccgaatgctgttttatgaaaaacaactctccatagacggcaccatggcg
tgcgcctcttgccatcaacaggccaaagccttcacggacggcaagaaaatcagcactggg
gtgaacggtacccctggcgacaaaaatgccatgtcactggccaacctgcactggacatcc
cggttcttttgggacggaagggcggccagcctggaggagcaagccttgcaacccattgag
gaccatcgggaaatgaatttgcccatagcagaagctgtggcccgactccaagccgacgaa
aattaccctgagcgatttgagaaagcatttggctcaaatcaaatcacggaaaccatgatc
ggaaaggcccttgcgcagttcatgcgcactttgatctcaggtgattcgaggtttgaccag
tggatcaggggtgaggtggaatttaccgaacaagagcaactggggatggagcttttcttc
acccacccagaaccttccctgcacattcgcggcggtaactgcggagactgtcacttgggc
tttttgacctctggtgaccgcaataaccttctgggctttcataacaatggccttgaccaa
gacgcctaccttgaggaaggtttggccgcagtaaccggacttcccaaggacaaaggaaaa
ttcaaagcccctaccctccggaacatcgcccttacagcaccttatatgcatgatggacgg
tttgaaacactaacggaagtcctggagcactatgatgaacacatccagatgaacagcacg
ttggatatcctcattttggaggccagcaatgagacgattgctcctggagagaacatcaaa
ctatacctgacggacggagaaaaagaagccatactgtcctttctgcacaccctgacggat
gaaaaattcattaccaatccgaaattctcggatccatttaattaa

DBGET integrated database retrieval system