KEGG   Echinicola vietnamensis: Echvi_4023Help
Entry
Echvi_4023        CDS       T02388                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
evi  Echinicola vietnamensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4817446..4818507
Genome map
AA seq 353 aa AA seqDB search
MKTTVTYRLILALAVGSLLSGCLQDAAETMKPNPEYYLPEVSATLQQPAFPQPSRNPISE
EGVLLGKTLFYDPRLSANGQVACSSCHLPALAFGDGVDLTAAGVSGKTLHRHSPTLFNLA
WHDGLFWDGGATNLESLVFGPLTHPDEMGADLNKVIPYLRESPAYPSLFKAAFQTDSITS
ALMGRALAQFVRTLISQDSRYDQWKRNEATLSEEEIQGYRLYQQHCSSCHKEGLFTDLRY
HNNGLDQTYPDPYELEGLLLGRYRISFDEMDRGAYKTPSLRNLLFTAPYMHDGRFATLDE
VLDHYEKGIQLNESLAPELENGIRLSHTEREALLAFLATLSDHQFIHNKAYQE
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaacaaccgtcacatatcgccttatcttggccttggctgtgggaagtttgctctca
ggatgcttgcaagacgctgcggaaaccatgaaaccaaacccggaatattaccttcccgag
gtttctgctaccctgcaacagccagcatttccacagccctccagaaaccccattagcgag
gagggcgtcctattgggcaaaaccctcttctatgacccgaggctttcggccaatggccaa
gtagcctgtagcagctgccatctgcctgcgctggccttcggtgacggggtagacttgact
gcagcgggggtgtccggcaaaacactccacaggcactcccctacgctgtttaacctcgct
tggcacgatggcttgttttgggacgggggagcgaccaacttggaatcactggtttttggt
cccttgacccatccagatgaaatgggggcagacctgaacaaggtcattccatacctgcgt
gaaagcccagcatacccttcgctcttcaaggctgcttttcagacagattccattaccagc
gcccttatgggcagggccttggcccaatttgtccgaacactcatctctcaagacagtcgc
tacgaccaatggaaaaggaatgaggccacccttagtgaggaagaaatccaagggtatcgc
ctctatcagcagcactgcagcagctgccataaggaaggcttgtttaccgacctgcgttac
cataacaacgggttggaccaaacttatcctgatccttatgaactggaaggcctgttgctg
gggagataccgaatttcttttgacgaaatggaccgtggagcctataagaccccttcattg
agaaacctcctattcaccgctccttatatgcatgacgggaggtttgctaccttggacgag
gtgctggaccattatgaaaaaggcatacagctcaacgaaagccttgccccggagctggaa
aatggcattcgactatcccatacagagcgggaggcccttttggctttcttggccaccctc
agcgatcaccaatttatccataataaagcttatcaagagtaa

DBGET integrated database retrieval system