KEGG   Echinicola vietnamensis: Echvi_4652Help
Entry
Echvi_4652        CDS       T02388                                 

Definition
(GenBank) peptidase family protein
Organism
evi  Echinicola vietnamensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5568888..5569940)
Genome map
AA seq 350 aa AA seqDB search
MNINTGLLKQICEVAGAPGFEKRIRELVIKEVTPLVDEVKVDNIGNVIAIKKGSKNPDGK
RVMVAAHMDEIGFIVTHIDDNGFLRFHTLGGFDPKTLTAQRVIVHGKKDLVGVMGSKPIH
VMTPEERNKLPKTTDYFIDLGMSKEEVEKYVQVGDSVTRDRELIEMGDCVNCKSIDNRVA
VFILIEALKAIENPPYDVYATFTVQEEVGLRGANVAAHGVNPDFGIALDTTIAFDVPGAS
PHEKVTELGKGTAIKVMDAMTICDYRMVDFMKKTADGHQIKWQPEILTAGGTDTAGVQRM
GKQGAIAGAISIPTRHMHQVIEMAHKHDIAASIKLLNACLENLDQYDWKH
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcaatacaggactgttgaagcaaatttgtgaagtggccggtgcacctggtttt
gaaaagcgaatcagggaattggtcatcaaggaagtgacgcctctggtagatgaggtgaaa
gtagacaatataggcaatgtgatcgcgatcaaaaaagggagcaaaaatcctgatggcaag
cgcgtgatggtggcggcccatatggatgaaataggctttatcgttacgcacatcgacgac
aatggctttttgcggtttcataccttgggaggattcgatcccaagaccctcactgcccaa
cgggtcattgtgcatggcaaaaaggatttggtaggggtgatgggcagcaaacccatccat
gtcatgacaccagaggaaagaaacaagcttcctaagaccaccgattattttatagatctg
gggatgagcaaggaagaggtggaaaaatacgtgcaagtgggagattctgtgaccagggat
cgcgagctgatcgaaatgggcgattgtgtaaactgtaagtccattgataacagggtggca
gtttttattttgatcgaggccttaaaggctatcgaaaatccaccttatgatgtctacgcc
acttttaccgttcaagaggaagtaggcctccgcggagccaatgtcgcggcccatggtgtc
aatcctgattttggcattgccttggatacgaccattgcgtttgatgtgcccggagcttct
ccgcatgaaaaggtcaccgagcttggaaaaggaactgccataaaggtaatggatgccatg
accatttgtgattacagaatggtagactttatgaaaaagacagctgacggccatcagatc
aagtggcagcctgagatccttaccgcaggcggcacggatacggcaggagtgcagcgtatg
gggaaacagggcgcgattgccggagcaatatccattcccaccaggcatatgcaccaagtc
attgaaatggcacataagcatgatattgccgcaagcatcaagctgctaaatgcctgtttg
gaaaaccttgatcagtacgattggaagcattga

DBGET integrated database retrieval system