KEGG   Echinicola vietnamensis: Echvi_4652Help
Entry
Echvi_4652        CDS       T02388                                 

Definition
peptidase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
evi  Echinicola vietnamensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:evi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Echvi_4652
Enzymes [BR:evi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Echvi_4652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5568888..5569940)
Genome map
AA seq 350 aa AA seqDB search
MNINTGLLKQICEVAGAPGFEKRIRELVIKEVTPLVDEVKVDNIGNVIAIKKGSKNPDGK
RVMVAAHMDEIGFIVTHIDDNGFLRFHTLGGFDPKTLTAQRVIVHGKKDLVGVMGSKPIH
VMTPEERNKLPKTTDYFIDLGMSKEEVEKYVQVGDSVTRDRELIEMGDCVNCKSIDNRVA
VFILIEALKAIENPPYDVYATFTVQEEVGLRGANVAAHGVNPDFGIALDTTIAFDVPGAS
PHEKVTELGKGTAIKVMDAMTICDYRMVDFMKKTADGHQIKWQPEILTAGGTDTAGVQRM
GKQGAIAGAISIPTRHMHQVIEMAHKHDIAASIKLLNACLENLDQYDWKH
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcaatacaggactgttgaagcaaatttgtgaagtggccggtgcacctggtttt
gaaaagcgaatcagggaattggtcatcaaggaagtgacgcctctggtagatgaggtgaaa
gtagacaatataggcaatgtgatcgcgatcaaaaaagggagcaaaaatcctgatggcaag
cgcgtgatggtggcggcccatatggatgaaataggctttatcgttacgcacatcgacgac
aatggctttttgcggtttcataccttgggaggattcgatcccaagaccctcactgcccaa
cgggtcattgtgcatggcaaaaaggatttggtaggggtgatgggcagcaaacccatccat
gtcatgacaccagaggaaagaaacaagcttcctaagaccaccgattattttatagatctg
gggatgagcaaggaagaggtggaaaaatacgtgcaagtgggagattctgtgaccagggat
cgcgagctgatcgaaatgggcgattgtgtaaactgtaagtccattgataacagggtggca
gtttttattttgatcgaggccttaaaggctatcgaaaatccaccttatgatgtctacgcc
acttttaccgttcaagaggaagtaggcctccgcggagccaatgtcgcggcccatggtgtc
aatcctgattttggcattgccttggatacgaccattgcgtttgatgtgcccggagcttct
ccgcatgaaaaggtcaccgagcttggaaaaggaactgccataaaggtaatggatgccatg
accatttgtgattacagaatggtagactttatgaaaaagacagctgacggccatcagatc
aagtggcagcctgagatccttaccgcaggcggcacggatacggcaggagtgcagcgtatg
gggaaacagggcgcgattgccggagcaatatccattcccaccaggcatatgcaccaagtc
attgaaatggcacataagcatgatattgccgcaagcatcaagctgctaaatgcctgtttg
gaaaaccttgatcagtacgattggaagcattga

DBGET integrated database retrieval system