KEGG   Exiguobacterium sp. MH3: U719_00770Help
Entry
U719_00770        CDS       T02903                                 

Definition
esterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
exm  Exiguobacterium sp. MH3
Brite
Enzymes [BR:exm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     U719_00770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
128359..129126
Genome map
AA seq 255 aa AA seqDB search
MITKSKDLYLEGPGPAVLLLHSFTGSANEMRGLARFLHAAGYTCYAPNYAGHGESPERLF
ETTIEDVWQSAQVGLAFLQDRGHKDIFLIGQSLGGVMALRLAEQSGCAGLILLSTPILER
TIAGLEHRVRRYTERYFQFDDRSPEWIVDFVDRHFPRPEKDLWALQQFILDTGVVLPKIT
QPIALFLGALDDAVYHASLERIETTVPSRDQKKVLLPNSKHLLTLDRDKQLLFEEILIFL
KTHPVDSLKPPSAVQ
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
ttgattacgaaatcaaaggatctgtacttagaaggacccggacctgctgttttgttgtta
catagttttacgggaagtgcgaatgagatgcggggactcgctcgttttttacatgcagcc
ggctatacctgttacgcgcccaattacgccgggcacggggaatcgccggagcgcttgttt
gagacgacgatcgaagacgtctggcagtccgcgcaagtcggactcgcgtttttacaagat
cgaggacacaaagacatctttttgatcggacaatcactcggtggagtaatggcacttcga
ctagcagaacagtcaggatgcgctggactcatcttactctcgacgccgattcttgagcgg
acgattgcgggactcgagcaccgcgtccgtcggtatacggaacggtattttcagtttgac
gatcgttcaccggagtggatcgtagactttgtcgaccgtcattttccacgcccagaaaaa
gacttatgggcactacaacagttcattctcgacacaggagtcgtcttgccgaagatcacg
cagcccatcgctctattccttggcgccttagatgatgccgtctatcatgcgagtctcgag
cgaatcgaaacgacggtgccgagccgagatcagaaaaaggttcttcttccgaacagtaaa
catctactgacactcgatcgggataaacaacttttgttcgaagaaattctcatcttcttg
aagacgcatccggtagattccttgaaaccaccatctgctgtgcagtag

DBGET integrated database retrieval system