KEGG   Exiguobacterium sp. MH3: U719_03725Help
Entry
U719_03725        CDS       T02903                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
exm  Exiguobacterium sp. MH3
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:exm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    U719_03725
Enzymes [BR:exm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     U719_03725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
714290..715699
Genome map
AA seq 469 aa AA seqDB search
MSSKRLVIVGGGISGLAAAYYAEKQFPEMNITLLEAEGRLGGKVATYRDEGLTIERGPDS
YVARKHVLTDLIEEIGLGEQLVRNNTSQAYILDARGLHPIPKGAVMGIPTDLELFAETSL
LTEEEKAEVTERLLHPAPDLTIPETDIPLGEYLRPRLGDALVEKLIEPLLSGIYAGDIDR
MSTFATYPQFVANEQKAGSLFEGMRLMRPLDQQQGPTLKATGQFLSLATGLESLVERLEE
VLERTEIRLETPLRSIEREEGGRYRLETDHGPEYADDILLTIPHRQVVSLLPDATLPGLA
NLSTHSTATVTLIFDKETALPIDGTGFIVNRRAPYSITACTAIDQKWNHAAPNHTVLRAF
IGRPGKDALVRESDEMIERVVLEDLENICGRPLQPERVVISRLLDGLPAYTVGHAQRIQE
VREIVASHYPHIHLAGLAYDGVGLPDCVAGVKATLEQMALQQPEPCKES
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtaaacgtctcgtcatcgtgggcggtggtatatcaggacttgcagccgcctat
tatgcagagaagcagtttccagagatgaacatcacgttactcgaggcagagggtcgtctc
ggtggtaaggtggcgacatatcgggacgaaggattgacgatcgagcggggaccggattca
tacgtcgcacggaaacacgtgttgacggatctcatcgaagagatcggattaggggagcaa
ctcgttcgcaataacacgtcgcaagcgtatatcttggatgcgcgcggtctccacccgatt
ccaaaaggtgccgtcatgggcatcccgaccgatttagagttattcgcagagacgtctcta
ctgacggaagaagaaaaggcagaggtgacagaacgcttgcttcaccctgctcctgatttg
acgattccggaaacagacatcccattaggggaatacctgcgtccgcgtcttggagatgcg
ctcgtcgagaagctgatcgaaccgcttctttcaggcatctatgcgggtgatatcgaccgg
atgagtacgttcgcgacctacccgcaattcgttgcgaatgagcaaaaggctggaagcttg
ttcgaagggatgcgcctcatgcgtccgcttgatcaacaacaaggtccgacgctcaaagcg
acaggtcaattcctatcacttgctactggactcgagtctctcgtcgagcgtttagaagag
gtgctcgaacggacagagattcgtctagagacaccacttcgctccatcgaacgggaagaa
ggcgggcggtatcgtctcgaaacggatcatggtccagaatatgctgatgatattttgttg
acgattccgcatcgccaagtcgtgtccctgttaccagatgcgacgcttccagggcttgcg
aacctttcaacacactcgacggcgacggtcacgttgattttcgataaggaaacagcgtta
ccgattgatggaacgggattcatcgtcaaccgtcgggcgccgtattcaattacagcatgc
acggcgattgatcaaaagtggaatcatgcagcaccgaatcataccgtgctccgtgccttc
atcggacgccccggaaaagatgcactcgttcgtgaatctgacgaaatgattgaacgcgtc
gtcttagaagatcttgaaaacatctgtggtcgtccattgcaaccggaacgtgtcgtcatc
agtcgtctcttagacggcttaccggcctatacggtaggacatgcacagcggattcaagaa
gtgcgagaaatcgtcgcttctcattatccgcacattcatttagccggactcgcctatgat
ggtgttggattgccagactgtgtagcaggtgtcaaagcgacgcttgaacaaatggcgtta
caacaaccggaaccatgtaaagaatcatga

DBGET integrated database retrieval system