KEGG   Exiguobacterium sp. MH3: U719_03975Help
Entry
U719_03975        CDS       T02903                                 

Definition
alpha-amylase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
exm  Exiguobacterium sp. MH3
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:exm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    U719_03975
Enzymes [BR:exm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     U719_03975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
773337..774860
Genome map
AA seq 507 aa AA seqDB search
MRRGIMLLLLPLLLSIGLQPMTGEAAGWEKERMYFIMVDRFENGDPSNDKEADPENPKAF
QGGDLAGVTKRLDYIKEKGFTSIWLTPIFKNRPNGYHGYWTDDYYEIDPHFGTKEEFKRL
VKEAHKRDIKVVLDLVVNHLGPNHPMVKEKPEWFHKNQPIMNWNNPSEVENNWLFDLPDF
NTENPEVVDYLVDVANYWVDETGIDGYRLDTVRHVPASFWETFIPAVKEKHPDLFLLAEV
FDGDPRKIASYSKLGFDSVTNFPFYYGVKDQFARKNGSAEELDSVYNRDTTFNPNAKGLA
TFIDNHDVKRFITEAKIGGADEEERQLRLALFALYAAPGMPIVYQGTEVAMPGGEDPGNR
MMMTFDQNKKMQQYVKTLNEMRQDYPAFATGKQRLIAKNDHMAVYSRETKQQQVVYAINL
GEKKTSLRVSAKEIGDDQRLRGLLFSDLVRQDGDAYEITLDANSANSYVIEKSQVNWWSI
IAIGAIAPILALILLLVHRKRMQRQTK
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgagacgaggcataatgcttctcctcttgccgcttctcttgtctatcgggcttcaaccg
atgacgggtgaagcagcaggttgggaaaaagaacgaatgtatttcatcatggtcgaccgg
ttcgagaatggcgatccgagtaatgataaagaggcggatcctgaaaatccaaaagcgttc
caaggtggcgatttagcaggcgtgacgaaacgtctcgattacatcaaggaaaagggattc
acttcgatttggttaacgccgatctttaagaaccgtccgaacggttatcatggatactgg
acggatgattattacgagattgatccgcacttcggaacaaaggaagagtttaaacgtctc
gtcaaagaagcgcataaacgggatatcaaggtcgtccttgatcttgtcgtcaatcattta
ggaccaaatcatccgatggtgaaagaaaaaccggagtggttccataaaaatcaaccgata
atgaactggaataacccgtcggaagtcgagaataactggctgttcgatttaccggacttc
aatacggaaaatccagaagtcgtcgattatttagttgatgtcgcgaactactgggtcgat
gaaacgggtatagacggataccggctcgatacagttcgccatgtgccagcctcattttgg
gaaacgtttatcccagcagtcaaagaaaagcatccagacttattcttgttggctgaagta
ttcgatggagatccgcgaaaaatcgcgtcctattcaaaattaggttttgattccgtgacg
aacttcccgttttattatggagtcaaggatcagtttgcccgcaaaaatggttcagcggaa
gagctcgattcagtttataatcgagatactacgtttaatccgaatgccaagggacttgca
accttcattgataatcatgatgtcaagcgcttcatcacggaagcaaagattggtggagca
gacgaagaggaacggcagcttcggttggcgctgttcgcactctatgctgccccggggatg
ccgatcgtctaccaaggaacagaggtggcgatgccaggtggcgaggatcctggaaaccgg
atgatgatgacatttgatcaaaacaagaagatgcaacagtacgtaaaaacgttgaacgag
atgcgtcaggactacccagcgtttgcaacagggaagcaacgcttgatcgcaaaaaacgat
catatggcagtctactcacgggagacgaaacaacaacaagtcgtttacgcgatcaatctt
ggagaaaaaaagacgagcttacgcgtgtctgcgaaagaaatcggtgatgatcagcgtcta
agaggacttttattctcagacttggtgcgtcaagatggtgacgcctatgagatcacgctt
gatgcaaatagtgcgaacagctatgtcatcgaaaagtcacaagtcaactggtggtcgatc
atcgcaattggtgcgattgctccgattttagcgctcatacttcttctcgttcatcgtaaa
cgcatgcaacgtcaaacaaaataa

DBGET integrated database retrieval system