KEGG   Exiguobacterium sp. MH3: U719_03975Help
Entry
U719_03975        CDS       T02903                                 

Definition
(GenBank) alpha-amylase
Organism
exm  Exiguobacterium sp. MH3
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
773337..774860
Genome map
AA seq 507 aa AA seqDB search
MRRGIMLLLLPLLLSIGLQPMTGEAAGWEKERMYFIMVDRFENGDPSNDKEADPENPKAF
QGGDLAGVTKRLDYIKEKGFTSIWLTPIFKNRPNGYHGYWTDDYYEIDPHFGTKEEFKRL
VKEAHKRDIKVVLDLVVNHLGPNHPMVKEKPEWFHKNQPIMNWNNPSEVENNWLFDLPDF
NTENPEVVDYLVDVANYWVDETGIDGYRLDTVRHVPASFWETFIPAVKEKHPDLFLLAEV
FDGDPRKIASYSKLGFDSVTNFPFYYGVKDQFARKNGSAEELDSVYNRDTTFNPNAKGLA
TFIDNHDVKRFITEAKIGGADEEERQLRLALFALYAAPGMPIVYQGTEVAMPGGEDPGNR
MMMTFDQNKKMQQYVKTLNEMRQDYPAFATGKQRLIAKNDHMAVYSRETKQQQVVYAINL
GEKKTSLRVSAKEIGDDQRLRGLLFSDLVRQDGDAYEITLDANSANSYVIEKSQVNWWSI
IAIGAIAPILALILLLVHRKRMQRQTK
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgagacgaggcataatgcttctcctcttgccgcttctcttgtctatcgggcttcaaccg
atgacgggtgaagcagcaggttgggaaaaagaacgaatgtatttcatcatggtcgaccgg
ttcgagaatggcgatccgagtaatgataaagaggcggatcctgaaaatccaaaagcgttc
caaggtggcgatttagcaggcgtgacgaaacgtctcgattacatcaaggaaaagggattc
acttcgatttggttaacgccgatctttaagaaccgtccgaacggttatcatggatactgg
acggatgattattacgagattgatccgcacttcggaacaaaggaagagtttaaacgtctc
gtcaaagaagcgcataaacgggatatcaaggtcgtccttgatcttgtcgtcaatcattta
ggaccaaatcatccgatggtgaaagaaaaaccggagtggttccataaaaatcaaccgata
atgaactggaataacccgtcggaagtcgagaataactggctgttcgatttaccggacttc
aatacggaaaatccagaagtcgtcgattatttagttgatgtcgcgaactactgggtcgat
gaaacgggtatagacggataccggctcgatacagttcgccatgtgccagcctcattttgg
gaaacgtttatcccagcagtcaaagaaaagcatccagacttattcttgttggctgaagta
ttcgatggagatccgcgaaaaatcgcgtcctattcaaaattaggttttgattccgtgacg
aacttcccgttttattatggagtcaaggatcagtttgcccgcaaaaatggttcagcggaa
gagctcgattcagtttataatcgagatactacgtttaatccgaatgccaagggacttgca
accttcattgataatcatgatgtcaagcgcttcatcacggaagcaaagattggtggagca
gacgaagaggaacggcagcttcggttggcgctgttcgcactctatgctgccccggggatg
ccgatcgtctaccaaggaacagaggtggcgatgccaggtggcgaggatcctggaaaccgg
atgatgatgacatttgatcaaaacaagaagatgcaacagtacgtaaaaacgttgaacgag
atgcgtcaggactacccagcgtttgcaacagggaagcaacgcttgatcgcaaaaaacgat
catatggcagtctactcacgggagacgaaacaacaacaagtcgtttacgcgatcaatctt
ggagaaaaaaagacgagcttacgcgtgtctgcgaaagaaatcggtgatgatcagcgtcta
agaggacttttattctcagacttggtgcgtcaagatggtgacgcctatgagatcacgctt
gatgcaaatagtgcgaacagctatgtcatcgaaaagtcacaagtcaactggtggtcgatc
atcgcaattggtgcgattgctccgattttagcgctcatacttcttctcgttcatcgtaaa
cgcatgcaacgtcaaacaaaataa

DBGET integrated database retrieval system