KEGG   Exiguobacterium sp. MH3: U719_05105Help
Entry
U719_05105        CDS       T02903                                 

Definition
cytochrome C oxidase subunit II
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
exm  Exiguobacterium sp. MH3
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:exm00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(996118..997659)
Genome map
AA seq 513 aa AA seqDB search
MKQKRWILATVASAAFLAPLAQPIAVGATADNGTMMQYFEWYVPNDGNHWNRLGSDATKL
DQLGITSVWIPPAYKGTSQNDVGYGAYDLYDLGEFNQKGTVRTKYGTKAQLKTAIGQLHT
AGIDVYGDVVMNHKGGADFTEAVTAVEVNPGNRNQEVSGDYQIQAWTGFNFAARNNLYSN
FKWKWYHFDGTDWDQSRSKSAIYKFRGTGKAWDTDVSTENGNYDYLMYADLDFDHPEVQQ
EMKNWGKWYVNELGLDGFRLDAVKHIKHGYLADWLANVRQTTGKPLFTVAEYWQNDLGTL
QNYLSRTNYQQSVFDAPLHYKFEQASKGGGYYDMRTIFDGTLVKSNPVQAVTLVENHDSQ
PGQSLESTVQSWFKPLAYAMILTREQGYPSVFYGDYYGTKGTSNREIPALASKIDPLLKA
RKDFAFGKQNDYLDNQDIIGWTREGVSDRAKSGLATILSDGPGGSKWMYVGLQNKGEVWT
DITGNNTASVTINQDGYGQFFVNGGSVSVYRQQ
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaaaaaagatggattttagcaaccgtcgcatccgctgcttttttagcgccactt
gcgcaaccgattgcagtcggcgcaacggcagacaacggaacgatgatgcagtatttcgaa
tggtatgtgccaaatgatggtaaccactggaaccgtcttgggagtgacgcaacaaagctt
gatcagctcggaatcacatcggtctggattccccctgcttacaaaggtacctcgcaaaat
gatgtcggatacggcgcctacgatctatacgatttaggtgagttcaatcaaaaaggaacg
gtccgtacgaaatacggcacaaaggcgcaattaaaaacggcgatcggacaattgcatacc
gctggaatcgatgtctatggtgatgtcgtcatgaaccataaaggtggcgccgatttcacg
gaagccgtcacggcagtcgaagtcaacccgggtaaccgtaatcaagaagtctctggcgat
tatcaaatccaggcatggacgggtttcaattttgcagcacgaaataacctctactcgaac
ttcaagtggaaatggtaccacttcgacggcacggactgggatcaatcacgttctaagagt
gccatctacaagttccgcggtaccggtaaagcgtgggatacggatgtctcaactgaaaat
ggcaactacgattacttgatgtatgcggatctcgacttcgatcatccagaagtccagcaa
gaaatgaagaactggggtaaatggtacgtcaacgaacttggtcttgatgggttccgtctc
gatgccgtcaagcatatcaaacacggttacttagcggactggctcgcgaatgttcgtcag
acgacgggcaaaccattgtttacagtcgcagagtactggcagaacgatctcggcacgttg
caaaactacttaagccggacgaattatcaacaatccgtctttgatgcgccgcttcattat
aagttcgaacaggcaagtaaaggcggcgggtattacgacatgcggacgatctttgatggt
actctcgtcaagagcaatccagtccaggccgtcacactcgtagagaaccatgattcgcag
cctggacaatcgcttgaatcaacggttcagtcatggttcaaaccgcttgcttacgcgatg
atcctgacacgtgaacaagggtatccgtcggtcttctatggtgactactatggtacaaag
ggtacgtcgaatcgcgaaattccagcactcgcttcgaagattgatccgttactcaaagca
cggaaggacttcgcgttcgggaaacaaaatgattaccttgataaccaagacatcatcggt
tggacacgtgaaggtgtctcagaccgggcaaaatcaggtcttgcgacaatcctttcggat
ggtcctggcggtagcaagtggatgtacgtcgggcttcagaacaaaggagaagtctggaca
gacatcactggaaacaacacagcatcggtcacgatcaaccaagatggttacggtcaattc
ttcgttaacggtggttcggtctccgtctatcgtcaacaataa

DBGET integrated database retrieval system