KEGG   Exiguobacterium sp. MH3: U719_08310Help
Entry
U719_08310        CDS       T02903                                 

Definition
(GenBank) amine oxidase
  KO
K00274  monoamine oxidase [EC:1.4.3.4]
Organism
exm  Exiguobacterium sp. MH3
Pathway
exm00260  Glycine, serine and threonine metabolism
exm00330  Arginine and proline metabolism
exm00340  Histidine metabolism
exm00350  Tyrosine metabolism
exm00360  Phenylalanine metabolism
exm00380  Tryptophan metabolism
exm01100  Metabolic pathways
exm01110  Biosynthesis of secondary metabolites
Module
exm_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:exm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    U719_08310
   00330 Arginine and proline metabolism
    U719_08310
   00340 Histidine metabolism
    U719_08310
   00350 Tyrosine metabolism
    U719_08310
   00360 Phenylalanine metabolism
    U719_08310
   00380 Tryptophan metabolism
    U719_08310
Enzymes [BR:exm01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     U719_08310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 Pyr_redox Pyr_redox_2 DAO HI0933_like FAD_binding_2 ApbA NAD_binding_9 AlaDh_PNT_C FAD_binding_3 Lycopene_cycl Glyco_transf_4 UDPG_MGDP_dh_N 3HCDH_N NAD_binding_2 Glyco_trans_4_4 F420_oxidored FMO-like
Motif
Other DBs
NCBI-GeneID: 17605990
NCBI-ProteinID: AHA29728
Position
1530313..1531365
Genome map
AA seq 350 aa AA seqDB search
MNVAIIGAGISGLYLATRMQELGHDVTIYEARDRIGGRIETVDFDLAGQAYAFDLGPTWF
WPDSEPLMVDLIHRFDLPTLEQYTTGALRLERADGIESHVVANQPTALRLRDGIRSVPTA
LAARLRPGTIRLKSPISQIDVTNRRVISSGRKSQPFDEIVLALPPRLAARLSYVPALPEA
VLDELEALPTWMAQQAKCLVLYERPFWRDSGWSGQAISWTGMVQEIHDASPQDGSGALFG
FFRTPARERQLLTEAEIKETVLAQLVRLFGEQARQSIGWAYKDWSTDSWTATRADAAPLV
DFPAYHAINLGVEHAAISLIGTETDPSHGGHLEGAIRSVERYLEKRGVKK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaacgttgccatcattggagcaggaatcagtggtttatatctcgcgacgcgtatgcag
gagcttggacacgacgtgacgatctatgaagcacgcgaccgaatcggtgggagaattgag
acggtcgatttcgacctagccggacaagcatatgcgtttgatcttggaccgacttggttt
tggccggacagtgaaccactgatggttgatttgatccatcgattcgatttaccgacactg
gaacaatacacgacgggtgcgcttcgactcgaacgggctgacggaatcgagtcgcatgtg
gttgcgaatcaaccgacggcgcttcgccttcgtgacggaatccgctctgttcctacggca
cttgctgcacgactcagaccgggaacgattcgactcaagtctccgatcagtcagattgat
gtcacgaaccggagggtcatcagttcaggaaggaagagtcaaccgttcgatgagatcgtt
ctcgcactcccaccacgtttagcggcaagactatcgtatgtgccagctttacctgaagca
gtcctggatgaactcgaagcattaccgacctggatggcgcagcaagcaaaatgtcttgtt
ctttacgaaagaccgttttggcgtgattcgggctggtccggtcaggcaatcagctggact
gggatggtgcaggagattcatgacgcttccccacaagatggatcaggagcgttgttcggt
tttttccggacaccggcacgtgaacgacagttattgaccgaggcggaaatcaaggaaacg
gtactcgcgcagctggttcgtctgttcggtgaacaagcgcgtcagtcgattggttgggcg
tataaagactggtcgacggatagttggacagcaacacgagctgatgcagcaccgctcgtg
gatttcccggcatatcatgctatcaatctcggagtggagcatgcagcgatttcactgatt
gggacagagaccgatccgagtcatggtggacacttagaaggggccatacgatccgttgaa
cgctatttagaaaagagaggagtaaaaaaatga

DBGET integrated database retrieval system