KEGG   Exiguobacterium sp. MH3: U719_08310Help
Entry
U719_08310        CDS       T02903                                 

Definition
amine oxidase
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
exm  Exiguobacterium sp. MH3
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:exm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    U719_08310
   00330 Arginine and proline metabolism
    U719_08310
   00340 Histidine metabolism
    U719_08310
   00350 Tyrosine metabolism
    U719_08310
   00360 Phenylalanine metabolism
    U719_08310
   00380 Tryptophan metabolism
    U719_08310
Enzymes [BR:exm01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     U719_08310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1530313..1531365
Genome map
AA seq 350 aa AA seqDB search
MNVAIIGAGISGLYLATRMQELGHDVTIYEARDRIGGRIETVDFDLAGQAYAFDLGPTWF
WPDSEPLMVDLIHRFDLPTLEQYTTGALRLERADGIESHVVANQPTALRLRDGIRSVPTA
LAARLRPGTIRLKSPISQIDVTNRRVISSGRKSQPFDEIVLALPPRLAARLSYVPALPEA
VLDELEALPTWMAQQAKCLVLYERPFWRDSGWSGQAISWTGMVQEIHDASPQDGSGALFG
FFRTPARERQLLTEAEIKETVLAQLVRLFGEQARQSIGWAYKDWSTDSWTATRADAAPLV
DFPAYHAINLGVEHAAISLIGTETDPSHGGHLEGAIRSVERYLEKRGVKK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaacgttgccatcattggagcaggaatcagtggtttatatctcgcgacgcgtatgcag
gagcttggacacgacgtgacgatctatgaagcacgcgaccgaatcggtgggagaattgag
acggtcgatttcgacctagccggacaagcatatgcgtttgatcttggaccgacttggttt
tggccggacagtgaaccactgatggttgatttgatccatcgattcgatttaccgacactg
gaacaatacacgacgggtgcgcttcgactcgaacgggctgacggaatcgagtcgcatgtg
gttgcgaatcaaccgacggcgcttcgccttcgtgacggaatccgctctgttcctacggca
cttgctgcacgactcagaccgggaacgattcgactcaagtctccgatcagtcagattgat
gtcacgaaccggagggtcatcagttcaggaaggaagagtcaaccgttcgatgagatcgtt
ctcgcactcccaccacgtttagcggcaagactatcgtatgtgccagctttacctgaagca
gtcctggatgaactcgaagcattaccgacctggatggcgcagcaagcaaaatgtcttgtt
ctttacgaaagaccgttttggcgtgattcgggctggtccggtcaggcaatcagctggact
gggatggtgcaggagattcatgacgcttccccacaagatggatcaggagcgttgttcggt
tttttccggacaccggcacgtgaacgacagttattgaccgaggcggaaatcaaggaaacg
gtactcgcgcagctggttcgtctgttcggtgaacaagcgcgtcagtcgattggttgggcg
tataaagactggtcgacggatagttggacagcaacacgagctgatgcagcaccgctcgtg
gatttcccggcatatcatgctatcaatctcggagtggagcatgcagcgatttcactgatt
gggacagagaccgatccgagtcatggtggacacttagaaggggccatacgatccgttgaa
cgctatttagaaaagagaggagtaaaaaaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system