KEGG   Exiguobacterium sp. MH3: U719_14850Help
Entry
U719_14850        CDS       T02903                                 

Definition
esterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
exm  Exiguobacterium sp. MH3
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2812027..2812806
Genome map
AA seq 259 aa AA seqDB search
MNGGKIVMMNYPVLTGAEAFYFQGGSIGILICHGFNATPQSVRDVGEAFAAEGFTVYAPR
LRGHGTNVREFEQSTARCWKQSLQDGYERLQETCDQVFVIGQSMGATLALSLAADGIPFA
GIITINAALSVPSYESLSFEDGPEYLPEGAPDIKRAAFEIIYDLVPSRCAFELVRLMDET
KGRLGSILLPTLILYSATDHVVPPSSSDYLHQHIGTNDKRSYCLLNSYHVATLDHDQDLI
VRETIRFIEQSCQFSQETG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaatggaggaaaaatagtaatgatgaactatcctgtattgactggtgctgaagcgttt
tattttcaaggtggatcgatcggcattctaatctgtcatggttttaacgccactccgcaa
agtgtccgggacgtcggtgaggcattcgctgctgaaggttttaccgtctatgccccgcgc
ttacgtggacatggaacgaacgtccgcgagttcgaacaatcgactgctcgatgttggaag
caaagcctgcaagacggctatgaacgtttacaagaaacatgcgatcaagtcttcgtcatc
ggtcaatcgatgggtgcgacgcttgcgctgtcgctcgccgctgacgggattccgtttgcc
ggcatcattacgatcaatgccgcactctccgttccatcctatgaatcactttcgttcgag
gacggtccagagtatttaccggaaggcgcaccggacattaagcgagcagcctttgaaatc
atctatgatcttgttccgagccgttgtgcgttcgaacttgttcgcctaatggatgaaaca
aaaggacgccttggatcgatccttctaccgacattgattctttactcagcgaccgatcac
gtcgttccaccttcgagctcggattatctgcaccagcacatcggaacaaatgataaacga
agctactgtttactgaactcgtatcacgttgcgacactcgatcatgatcaggatttgatt
gttcgtgagacgattcgctttatcgaacaatcgtgtcagttttcgcaagaaacaggctga

DBGET integrated database retrieval system