KEGG   Eggerthella sp. YY7918: EGYY_01560Help
Entry
EGYY_01560        CDS       T01566                                 

Definition
hypothetical protein
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
eyy  Eggerthella sp. YY7918
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:eyy01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:eyy00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
160025..161452
Genome map
AA seq 475 aa AA seqDB search
MKHEELTKKIDTYLEENWDAMVGDIETLVRIPSFQENDKKAEGAPFGPGPKKALTAALKL
ASDMGFASHDAEGYIGFADFAGQSDTQIGIIGHMDVVPAGPGWTFEPYAVTRKEGYLIGR
GTLDDKGPSVVALHAMKFWKDLQDAGEAPQFPYTIRFLFGANEESGMADVAYYHEHYDDP
AFLFTPDAEFPVCYGEKGGYDGQITSKPLDASSRIVVEFEGGAATNAVPGIAHAVVKADA
AALPAADRITVTEAGAGLARIEAKGKGAHASTPDEGINAIGLIVNYLLANDLCSPDERAF
FELDQKLLNHSDGSGLGIKTEDEYFGPLTIIGGTIKLEDDRFVQTLDSRFPTSITADEIT
EHVRQLADEIGATFENTLLMEPFLVKPDSPVIQALLDAYNEATGEDAKPFTMGGGTYARE
FKSGASFGPEKPWIKDPEWVGMMHGPDEGVSEELLKQSFKIYALTIEKLMQLDLK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacgaagaactgaccaaaaaaatcgatacctaccttgaagaaaactgggacgca
atggtgggggacatcgaaacgctcgtccgcattcccagtttccaagagaatgacaaaaaa
gccgagggtgcacccttcggccctggtccgaaaaaggcgctgacggctgcgctcaagctg
gctagcgacatgggtttcgcctctcatgatgccgaggggtatatcggattcgccgacttc
gctggccaaagcgacacacagattggcattatcggccacatggacgttgttccggcaggt
cccggctggacgtttgaaccttacgccgtcacgcgcaaggaaggctaccttatcggtcgc
ggcacgcttgacgacaagggtcccagcgtggtggcgctgcatgccatgaagttctggaag
gatttgcaagatgcaggggaggcgccccagtttccctataccatccgcttcctgttcggc
gcgaacgaggaatctggcatggccgatgtggcgtactatcacgagcactacgacgatccg
gccttcctgttcacgcccgacgcggaatttcccgtgtgttacggcgaaaagggcggctat
gacggccagataaccagcaagcctcttgatgcaagctctcgcatagtggttgaatttgaa
ggcggcgcggccaccaacgccgtgccgggcattgctcatgcggtcgtgaaagccgatgcg
gctgcgctgcctgcggctgatcgcatcaccgttaccgaagccggtgcgggtcttgcgcgc
attgaggccaagggtaagggcgcgcacgcttcaacgcccgacgagggcatcaacgccatc
ggccttattgtgaactatctgctggccaacgatctgtgttcgcccgacgagcgcgcattc
ttcgagcttgaccagaagctgctgaatcattcggacggtagcggtcttggcatcaagaca
gaagatgagtacttcggcccgctcaccattatcggcggcaccatcaagttggaagacgac
cgcttcgtccagacgctcgacagtcgcttccccacgtctattaccgccgatgaaatcacc
gagcatgtgcgtcaactggccgacgagattggagcaacgtttgaaaacacgctgctcatg
gagccgttcttggtaaagccggacagcccggtcatccaagcgctgcttgacgcatacaac
gaggccaccggcgaggatgccaagcccttcaccatgggcggcggcacctacgctcgcgaa
tttaagagcggagcaagcttcggtcccgaaaagccgtggattaaagaccccgagtgggtg
ggcatgatgcacggtcccgacgagggcgtgagcgaggagcttttgaagcagtcgttcaag
atttatgcgctcaccatcgagaagcttatgcagcttgacttgaagtag

DBGET integrated database retrieval system