KEGG   Eggerthella sp. YY7918: EGYY_02190Help
Entry
EGYY_02190        CDS       T01566                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
eyy  Eggerthella sp. YY7918
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eyy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EGYY_02190
   00052 Galactose metabolism
    EGYY_02190
   00500 Starch and sucrose metabolism
    EGYY_02190
   00520 Amino sugar and nucleotide sugar metabolism
    EGYY_02190
Enzymes [BR:eyy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EGYY_02190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
218216..219028
Genome map
AA seq 270 aa AA seqDB search
MKALIPAAGLGTRFLPATKAQPKEMLLVVDRPAIQYVVEEGLASAADEVVIINSREKKAI
EDHFSPNPELVELLRARGKDKYADLVEQVGAYNVSYVYQDEALGLGHAVRCAAEKTGDEP
FYVLLGDVLVPDNQMLPRMQEVSDAHGGASVIAVMPVPDEEVSRFGVIAGAAVSDDVWKV
DALVEKPALEDAPSNLAVFGRYLLSPRVMELLADVQPGVGGEIQLTDALDAVLQEEEMYA
LVIDPTDGFDTGTVESWLETNNILYARKNG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctctcatccctgcggccggtctcggcacacgctttttgcccgccacgaaggcg
cagccgaaggaaatgctgctcgttgtggatcgtcctgccattcagtacgtggtggaggag
ggtctggcatcggcggccgacgaagtggttatcatcaacagccgtgagaagaaggcgatc
gaagatcatttctcgccgaatcccgagctggtggagttgctgcgggcgcgcggcaaggac
aagtacgccgacctggtggagcaggtgggtgcgtacaacgtgagctatgtgtatcaggat
gaggcgctgggcctcggtcacgccgtgcgttgtgccgcggagaaaacgggtgacgagccg
ttctacgtactgttgggcgacgtgctggtgcccgacaaccagatgctgccccgtatgcag
gaagtgtccgacgcgcacggtggcgcaagcgtgatcgccgtgatgcccgtgccggacgag
gaagtgagccgcttcggtgtcatcgctggtgccgcggtgtccgacgacgtgtggaaggtg
gatgcgctggtggaaaagcccgcgcttgaagacgcgccgtcgaatctggccgtgtttggt
cgctatctgctgtcgccgcgcgtgatggagctgctggctgacgtgcagcccggtgtgggg
ggcgaaatacagctgaccgacgcgctcgatgccgttctgcaagaggaagagatgtatgcc
ctcgtcatcgatcccaccgacggtttcgacaccggcaccgtcgaaagctggctggaaacc
aataacatcctctacgcccgcaagaacgggtag

DBGET integrated database retrieval system