KEGG   Eggerthella sp. YY7918: EGYY_03550Help
Entry
EGYY_03550        CDS       T01566                                 

Definition
hypothetical protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
eyy  Eggerthella sp. YY7918
Pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eyy00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    EGYY_03550
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    EGYY_03550
Enzymes [BR:eyy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     EGYY_03550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
394264..395634
Genome map
AA seq 456 aa AA seqDB search
MRCYTTDGRGAFRHTDRAFHRDERAEMGLVVCRPDKTYQRIVGFGGAFTEAAASVFAQMP
PDVQDDFLLQCFGRAPEVHAGQGGNAYTLCRTHIQSCDFALGNYAYVRPFDRALQTFSIS
RDQQLLLPFIKCGLAVNPHFQLFASPWSPPAFMKTNRRMNGGGRLRHSCYEAWANLLVRY
VDAYAREGVRIGRMSIQNEPMACQTWDSCLFTAEEEAEFAAHFLRPALDAAGYEDVVLFA
WDHNTDRILERVEATFAYPDADAAFGGCALHWYAGDHFEQVRAVAEAYPNKELLFTEGCV
EYSLDQAKEATQERKAEQYAHAVIGHLNAGAHGFIDWNLLLDERGGPNHVGNFCEAPLMY
DRAAQQLIVNRSFHYLGHFSRFVVPGSQRFLTSRFTDDIECVGFVRPDSTRVLVILNRRA
HEARLSVAERPWVARVEVPAHSIVTLTWDSNEVCAP
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgcgctgttatacaaccgatggtcggggcgcgtttcgtcataccgatagggcgtttcat
cgtgacgagcgagctgagatggggcttgtcgtgtgccgccccgataagacctatcagcgt
atcgtggggtttggcggtgcctttaccgaagcggccgcttcggtgttcgcacagatgccg
cccgatgtgcaggatgattttctgctgcagtgcttcgggcgtgcgccggaggtccatgcg
gggcagggcggcaatgcgtacacgctgtgccgtacgcatattcaaagctgtgattttgcc
ttgggaaattacgcctatgtgcgcccgttcgaccgcgcattgcaaaccttctctatcagc
cgcgaccaacagcttttgctgccgtttatcaagtgcggcttggcagtgaacccgcacttt
cagttgtttgcctcgccatggagccctccggccttcatgaagaccaaccgtcgcatgaac
gggggaggccgtttgcggcattcatgctatgaagcgtgggcgaacctgcttgtgcgttac
gtggatgcctatgcgcgcgaaggtgtgcgcatcggtcgcatgagcatacaaaacgagcct
atggcatgccaaacctgggattcctgtttgttcactgccgaggaagaagccgaatttgcc
gcacattttcttcgtccggcacttgatgctgcaggctatgaggacgttgtgctgttcgcc
tgggatcacaacaccgatcgcattcttgagcgcgttgaggcaacgtttgcgtatccggat
gccgacgcggcgtttggcgggtgtgcgctgcactggtatgccggagatcatttcgaacag
gtgcgtgcagtcgccgaggcgtatcccaataaggagctgctgtttaccgaaggatgtgtg
gaatactcactcgatcaggcgaaggaggctacgcaggagcgcaaagccgagcagtatgca
cacgcggtgataggtcacttgaacgcaggtgcgcacgggtttatcgactggaacctgctg
cttgatgagcgtggtggtccgaaccatgtaggcaacttctgcgaagctccccttatgtat
gatcgtgcggcgcagcagcttatcgtgaaccggtcgtttcattatttgggtcatttttcg
cgcttcgtcgtgccgggttcgcagcgctttttgacctcgcgtttcaccgacgacatagag
tgcgtcggctttgtgcggccggacagcactcgtgtgctggtgattctgaatcgtcgtgcg
catgaggcgcgcctgtccgtggcagagcgcccttgggtcgcacgagttgaggtgcccgcg
catagcatcgtaacgcttacctgggattccaacgaggtttgcgccccgtag

DBGET integrated database retrieval system