KEGG   Eggerthella sp. YY7918: EGYY_03550Help
Entry
EGYY_03550        CDS       T01566                                 

Definition
hypothetical protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
eyy  Eggerthella sp. YY7918
Pathway
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
394264..395634
Genome map
AA seq 456 aa AA seqDB search
MRCYTTDGRGAFRHTDRAFHRDERAEMGLVVCRPDKTYQRIVGFGGAFTEAAASVFAQMP
PDVQDDFLLQCFGRAPEVHAGQGGNAYTLCRTHIQSCDFALGNYAYVRPFDRALQTFSIS
RDQQLLLPFIKCGLAVNPHFQLFASPWSPPAFMKTNRRMNGGGRLRHSCYEAWANLLVRY
VDAYAREGVRIGRMSIQNEPMACQTWDSCLFTAEEEAEFAAHFLRPALDAAGYEDVVLFA
WDHNTDRILERVEATFAYPDADAAFGGCALHWYAGDHFEQVRAVAEAYPNKELLFTEGCV
EYSLDQAKEATQERKAEQYAHAVIGHLNAGAHGFIDWNLLLDERGGPNHVGNFCEAPLMY
DRAAQQLIVNRSFHYLGHFSRFVVPGSQRFLTSRFTDDIECVGFVRPDSTRVLVILNRRA
HEARLSVAERPWVARVEVPAHSIVTLTWDSNEVCAP
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgcgctgttatacaaccgatggtcggggcgcgtttcgtcataccgatagggcgtttcat
cgtgacgagcgagctgagatggggcttgtcgtgtgccgccccgataagacctatcagcgt
atcgtggggtttggcggtgcctttaccgaagcggccgcttcggtgttcgcacagatgccg
cccgatgtgcaggatgattttctgctgcagtgcttcgggcgtgcgccggaggtccatgcg
gggcagggcggcaatgcgtacacgctgtgccgtacgcatattcaaagctgtgattttgcc
ttgggaaattacgcctatgtgcgcccgttcgaccgcgcattgcaaaccttctctatcagc
cgcgaccaacagcttttgctgccgtttatcaagtgcggcttggcagtgaacccgcacttt
cagttgtttgcctcgccatggagccctccggccttcatgaagaccaaccgtcgcatgaac
gggggaggccgtttgcggcattcatgctatgaagcgtgggcgaacctgcttgtgcgttac
gtggatgcctatgcgcgcgaaggtgtgcgcatcggtcgcatgagcatacaaaacgagcct
atggcatgccaaacctgggattcctgtttgttcactgccgaggaagaagccgaatttgcc
gcacattttcttcgtccggcacttgatgctgcaggctatgaggacgttgtgctgttcgcc
tgggatcacaacaccgatcgcattcttgagcgcgttgaggcaacgtttgcgtatccggat
gccgacgcggcgtttggcgggtgtgcgctgcactggtatgccggagatcatttcgaacag
gtgcgtgcagtcgccgaggcgtatcccaataaggagctgctgtttaccgaaggatgtgtg
gaatactcactcgatcaggcgaaggaggctacgcaggagcgcaaagccgagcagtatgca
cacgcggtgataggtcacttgaacgcaggtgcgcacgggtttatcgactggaacctgctg
cttgatgagcgtggtggtccgaaccatgtaggcaacttctgcgaagctccccttatgtat
gatcgtgcggcgcagcagcttatcgtgaaccggtcgtttcattatttgggtcatttttcg
cgcttcgtcgtgccgggttcgcagcgctttttgacctcgcgtttcaccgacgacatagag
tgcgtcggctttgtgcggccggacagcactcgtgtgctggtgattctgaatcgtcgtgcg
catgaggcgcgcctgtccgtggcagagcgcccttgggtcgcacgagttgaggtgcccgcg
catagcatcgtaacgcttacctgggattccaacgaggtttgcgccccgtag

DBGET integrated database retrieval system