KEGG   Eggerthella sp. YY7918: EGYY_03890Help
Entry
EGYY_03890        CDS       T01566                                 

Definition
hypothetical protein
Orthology
K01923  
phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:6.3.2.6]
Organism
eyy  Eggerthella sp. YY7918
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:eyy00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
420921..421799
Genome map
AA seq 292 aa AA seqDB search
MAGMDIKPDSQGKVRDLYDLGDKLLLVATDRISAFDYILEDEIPHKGAVLTQLSCFWFEL
LDGVVENHLISADVADLPEQFQPYADYLRGRFMLVKKADMFPAECIVRGYLAGSGLKEYQ
KQGTVCGIQLPEGLVNSSKLPEPIFTPSTKAEIGDHDENISFERLVNIIGEDDAVQLRDL
SLKVYTTARDHAAERGVIIADTKFEFGRLDGKIILADEVLTPDSSRFWPGDEYAPGADQP
SFDKQYVRDWLTANWDRQGNPPRLPQEVIERTSEKYIQAYEKITGRTFVPFA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggcggggatggatatcaagcccgattcgcaaggtaaagtacgcgatctgtatgatctg
ggtgacaagctgttgctggttgcaacggaccgcatttcggcattcgactacattttggaa
gacgagattccgcataagggtgcggtgctcacgcagctgtcgtgcttctggttcgagttg
ctggacggcgtggttgaaaaccacctgatcagcgccgatgtagctgatctgcccgagcag
ttccagccgtacgccgactacctgcgcggccgcttcatgctagtgaaaaaggccgatatg
ttccccgccgagtgcatcgtgcgcggctatttggcaggcagcggccttaaagagtatcag
aagcagggcacggtgtgtggcattcagctgcccgagggtctggtgaattcttcgaagttg
cccgaacccatcttcacgccgtcaacgaaggccgagattggcgaccacgacgaaaacatc
agcttcgagcgtttggtgaacatcatcggcgaggacgatgctgtgcagttgcgcgacctg
tcgctgaaggtgtacaccacggcgcgcgaccatgcggccgaacgcggcgtaattatcgcc
gatacgaagtttgagtttggccgcttggatggcaaaatcattctggccgatgaggtgctc
acacccgattcgtcacgcttctggcctggcgatgagtacgctcccggcgccgatcagccc
agcttcgacaagcaatatgtgcgcgattggctgaccgccaactgggatcgtcagggcaat
cctccgcggctgccccaagaggtgattgaacgtacgagcgagaagtacatacaagcctac
gaaaaaataaccgggcggacttttgttccgtttgcttaa

DBGET integrated database retrieval system