KEGG   Eggerthella sp. YY7918: EGYY_04530Help
Entry
EGYY_04530        CDS       T01566                                 

Gene name
PfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
eyy  Eggerthella sp. YY7918
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:eyy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EGYY_04530 (PfkA)
   01230 Biosynthesis of amino acids
    EGYY_04530 (PfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EGYY_04530 (PfkA)
   00030 Pentose phosphate pathway
    EGYY_04530 (PfkA)
   00051 Fructose and mannose metabolism
    EGYY_04530 (PfkA)
   00052 Galactose metabolism
    EGYY_04530 (PfkA)
  Energy metabolism
   00680 Methane metabolism
    EGYY_04530 (PfkA)
Enzymes [BR:eyy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EGYY_04530 (PfkA)
Protein phosphatases and associated proteins [BR:eyy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     EGYY_04530 (PfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(486716..487930)
Genome map
AA seq 404 aa AA seqDB search
MGNCLVAQSGGPTAVINASLAGVIRANQLNPLYDRVFGGLHGIEGVLDDKLYDLTDLTEH
EIELLKQTPSSALGTCRYKLKRGNDADYRRLVEVMDAHDIDVMFYIGGNDSMDTVDALAE
WAVANAPQKRFIGIPKTVDNDLVPVDHCPGFPSAAKLACQVTHATYLDYAAYTRPEVFVL
ETMGRDAGWLAASCCVTGDVDLLVLPEVDFDRDAFLAEVQKKFDEKGECYIVVSEGAHYA
DGRYLSAGDAANDGFAHAVLGGAALTLKQMIIDAGIVPRGVVQDLSRAARSSNFAQSLVD
VTEAYDLGMSAHMRSGDTAFTGQVVGVLRNEAAAAEGRYASEIFAGPASEFANFVKHFPT
EWILPNYQGISEEALAYFRPLIEGEPKLVMKGGLPATIVPFNKR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgggaaattgccttgttgcacaatccggcggccccaccgctgtcatcaacgccagtttg
gcgggcgtcattcgcgccaaccagctgaaccccctttatgatcgggtgttcgggggactg
cacggcattgagggcgtgctcgacgacaagctgtacgacctaaccgacctaaccgagcac
gaaatcgaactgctgaagcagacgccatcgtcagcactgggaacgtgtcgctacaaactt
aagcgcggcaacgatgccgactaccgccgattggtggaggtaatggatgcgcacgacatc
gatgtgatgttctacatcggcggcaacgattctatggacacggtggatgcgctggccgag
tgggccgtcgcgaatgctccgcagaagcgcttcatcggtattcccaagacggtcgacaac
gacctggttccggtagatcactgccccggcttccccagcgctgcaaagcttgcctgccag
gtgacgcacgccacgtatctggactacgccgcctacacgcgccccgaggtgtttgtgctg
gaaacgatgggacgcgacgcagggtggctcgccgccagctgctgcgtgaccggcgatgtc
gatttgctcgtgcttcccgaggtggattttgaccgcgacgctttcttggccgaagtacag
aagaagtttgacgaaaagggcgaatgctacatcgtggtttccgaaggcgcccactacgcc
gatggtcggtacctgtccgccggcgacgcggccaacgacgggtttgcccacgcagtgctg
ggcggtgcggcgctcactctcaagcagatgatcattgatgcaggcatcgtgccgcgcggc
gtggtgcaggatctgtcgcgcgcggcgcgttcaagcaactttgcacagagtctggttgac
gtgaccgaggcctacgacctgggcatgagcgcgcatatgcgcagcggcgacacggcgttt
acgggccaggtggtcggcgttttgcgcaacgaggccgctgccgccgaaggccgctacgcc
tccgagatattcgccggccccgccagcgagttcgcgaactttgtcaagcacttccccacc
gaatggattttgccgaactatcagggtatttccgaggaagcgctcgcttatttcaggccg
cttatcgaaggcgagcccaaactcgtgatgaaaggcggcctccccgccaccatcgtgccg
ttcaataaacgataa

DBGET integrated database retrieval system