KEGG   Eggerthella sp. YY7918: EGYY_04540Help
Entry
EGYY_04540        CDS       T01566                                 

Gene name
BglX
Definition
beta-glucosidase-related glycosidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
eyy  Eggerthella sp. YY7918
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eyy00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    EGYY_04540 (BglX)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    EGYY_04540 (BglX)
Enzymes [BR:eyy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     EGYY_04540 (BglX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(488093..489349)
Genome map
AA seq 418 aa AA seqDB search
MTLRIRTLLVCCTLLLFATCCFLGCSSRAQVSTESPSTEFPNASDIAEPSANSAGDQKSP
QPSGGQNADPKVSEKVASLTLEQKVAQMFIVTPEAITGVDTATLAGETTENALHTYPVGG
IAYFQKNLIDPDQTRALIANSQAFAQDACGLPLFIGVDEEGGTVSRIGGNPGFGIANADN
MAEVGATGNTAQAETVASTIGGYLSDLGFNLNFAPDSDICGDPATDVMALRSFGTDPTLV
AGMVSAQVKGFTEAGVLCCVKHFPGIGGVAGDSHDGSITTAKTLDELRAFELVPFKAAIE
ASTPFIMVGHLSAPNAFGDDTPASINPEAVTNLLRNELSYEGLIITDSMAMGAVTDRCTP
DRAGVLAIQTGVDIVLMPADFQAAYQGVLDAVASGEISEARIDESVTRIVKTKLERLR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgactttgcgcattcgcactcttttggtttgctgcaccctactactgtttgcgacttgc
tgctttctaggctgctcgtcacgcgcgcaggtttcaaccgaaagcccctcaaccgaattc
cccaacgcaagcgacatcgccgagccgagcgcgaacagcgccggcgaccagaaatcaccc
caaccttcgggtgggcagaacgccgatccgaaggtctccgaaaaggtggcctctttgaca
cttgagcaaaaagtcgcgcagatgttcatagtgacgcccgaagccatcacgggtgtcgat
acggcaacgctcgcaggcgagacgaccgaaaacgccctgcatacctatcccgtgggcggt
attgcatacttccagaagaaccttatcgaccccgaccagacacgtgcgctgatcgcaaac
tcgcaggctttcgcccaagatgcgtgcggccttccgctcttcatcggcgtggacgaagag
ggcggcaccgtctcgcgcattggcggcaaccctggttttggaattgcgaacgcggacaac
atggccgaggttggggcgacgggaaataccgcgcaggcagagactgttgccagcactatc
ggtggctacctgagcgatttgggattcaaccttaactttgcgcccgattccgatatttgc
ggcgaccctgccaccgatgtgatggctttgcggtcgtttggcaccgacccgacccttgtt
gccggtatggtatctgcccaggttaaaggcttcaccgaggcaggtgtgctgtgctgcgtc
aagcacttccccggcatcggcggcgttgcaggagacagtcacgacggttcgatcaccacg
gcgaagacgctcgatgagctgcgcgctttcgagcttgttccgttcaaggcagccattgag
gcgagcactccctttattatggtaggccatctgagcgcaccgaatgcgtttggcgacgat
acccccgcgtcgatcaacccggaggctgtcaccaatttgctacgcaatgagctgagctac
gaagggctcatcatcaccgattccatggctatgggcgcggtgaccgaccgatgcacgcct
gatcgagcgggcgtgcttgccattcagaccggcgttgatatcgtgctgatgcctgctgat
ttccaagcggcctaccaaggggttttggatgcggtggcaagcggcgagatttctgaagcg
cggattgatgaatcggtcacgcgcatcgtgaaaacgaagcttgagcgattacgctag

DBGET integrated database retrieval system