KEGG   Eggerthella sp. YY7918: EGYY_06740Help
Entry
EGYY_06740        CDS       T01566                                 

Definition
hypothetical protein
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
eyy  Eggerthella sp. YY7918
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eyy00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EGYY_06740
Enzymes [BR:eyy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     EGYY_06740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
724415..725695
Genome map
AA seq 426 aa AA seqDB search
MSATRRIVVLGSTGSIGTQTLDVVRQHADKLDVVGLAVGTRADELLVQAREFDVRHLAVG
DERLANEAVADELRSVILSEANEASAVESRAVFVTEGSEPSLGFGAEAVVDLVRLPEADL
VVNALVGAAGLRASYETLRAGKVLALANKESLVVGGDLIMPLAAQVDARRSAEGLAPASG
PAGALMPIDSEHGAIYQCLLGEDAREVSRLWVTASGGPFRGRTRDELASITPAQALAHPT
WNMGAKISIDSSTLMNKGLEVIEAHHLFAMDYDKISVVVQPQSAIHSMVEFTDGSVKAHL
GTTDMRIPIQFALSYPERWNAPVEPLDFRTLGTLEFAAPDEDTFRCLALARHAGKVGGTL
PCVMNAANEVAVAAFLAKEGSYLGIAACVEAVMNAHERAGVQRVESLEQLEELDAWSRTE
ARKNLR
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaactcgtcgcatcgttgttttgggatccaccggatcaatcggcacgcagacg
cttgatgtggtgcggcagcatgccgacaagctagatgtggtggggcttgccgttggtaca
cgagccgatgagctgctggtgcaagcacgcgaatttgacgtgcgccatctggcggtgggc
gacgagcgcttggcgaacgaagccgtggccgacgagctgcgctctgtcattctgagtgaa
gcgaacgaagcgagtgccgtcgaatcccgcgcggtgtttgtgacagaaggttctgagccg
tcgctcggctttggcgccgaagcggtggttgacctcgtgcgtcttccggaggccgacctt
gtggtgaacgcccttgtgggagctgccggtcttcgtgcgagctacgaaacgttgcgtgcg
ggtaaggtgctcgcgcttgccaacaaagaatcgctcgtggtgggcggcgaccttatcatg
ccgctcgctgcccaggttgatgcgcggcgcagcgcggaaggcctggcccccgcaagcggt
ccggcgggtgcgctcatgcctatcgactccgaacatggtgccatttaccaatgccttctt
ggcgaagacgcgcgcgaggtgtcgcgtttgtgggtgacggcatcgggcggccccttccgc
ggccgcacgcgcgacgagctggcgagcatcacacctgcccaggcgcttgcgcatcctacg
tggaacatgggtgcaaagatatccatcgattcgtccacactcatgaacaaggggcttgag
gttatcgaagcgcaccacctgtttgccatggactacgacaagatcagcgttgtcgtacag
ccgcagagtgccattcattcgatggtggaatttaccgacggcagcgtgaaagcgcacctc
ggcaccacagatatgcgcattcccattcagtttgcgctcagctatcccgagcgctggaac
gcgccggtcgaaccgcttgattttcgcacgctcggtacccttgagtttgccgcacccgat
gaagatacgtttcgttgtctcgccctcgcacgccatgcggggaaggtgggcggtacgctg
ccgtgcgtcatgaacgccgcgaacgaggtggccgtcgctgccttcttggcgaaagaggga
tcctacctcggcattgccgcctgtgtcgaagccgttatgaatgcccacgaacgtgccggt
gtccagcgggttgaaagtctcgaacagctcgaagaactcgatgcgtggtcgcgcaccgaa
gcgcgcaaaaacctccgatag

DBGET integrated database retrieval system