KEGG   Eggerthella sp. YY7918: EGYY_06740Help
Entry
EGYY_06740        CDS       T01566                                 

Definition
(GenBank) hypothetical protein
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
eyy  Eggerthella sp. YY7918
Pathway
eyy00900  Terpenoid backbone biosynthesis
eyy01100  Metabolic pathways
eyy01110  Biosynthesis of secondary metabolites
eyy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:eyy00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EGYY_06740
Enzymes [BR:eyy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     EGYY_06740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_redisom_C DXP_reductoisom Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: BAK43875
UniProt: F7UZD2
Position
724415..725695
Genome map
AA seq 426 aa AA seqDB search
MSATRRIVVLGSTGSIGTQTLDVVRQHADKLDVVGLAVGTRADELLVQAREFDVRHLAVG
DERLANEAVADELRSVILSEANEASAVESRAVFVTEGSEPSLGFGAEAVVDLVRLPEADL
VVNALVGAAGLRASYETLRAGKVLALANKESLVVGGDLIMPLAAQVDARRSAEGLAPASG
PAGALMPIDSEHGAIYQCLLGEDAREVSRLWVTASGGPFRGRTRDELASITPAQALAHPT
WNMGAKISIDSSTLMNKGLEVIEAHHLFAMDYDKISVVVQPQSAIHSMVEFTDGSVKAHL
GTTDMRIPIQFALSYPERWNAPVEPLDFRTLGTLEFAAPDEDTFRCLALARHAGKVGGTL
PCVMNAANEVAVAAFLAKEGSYLGIAACVEAVMNAHERAGVQRVESLEQLEELDAWSRTE
ARKNLR
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaactcgtcgcatcgttgttttgggatccaccggatcaatcggcacgcagacg
cttgatgtggtgcggcagcatgccgacaagctagatgtggtggggcttgccgttggtaca
cgagccgatgagctgctggtgcaagcacgcgaatttgacgtgcgccatctggcggtgggc
gacgagcgcttggcgaacgaagccgtggccgacgagctgcgctctgtcattctgagtgaa
gcgaacgaagcgagtgccgtcgaatcccgcgcggtgtttgtgacagaaggttctgagccg
tcgctcggctttggcgccgaagcggtggttgacctcgtgcgtcttccggaggccgacctt
gtggtgaacgcccttgtgggagctgccggtcttcgtgcgagctacgaaacgttgcgtgcg
ggtaaggtgctcgcgcttgccaacaaagaatcgctcgtggtgggcggcgaccttatcatg
ccgctcgctgcccaggttgatgcgcggcgcagcgcggaaggcctggcccccgcaagcggt
ccggcgggtgcgctcatgcctatcgactccgaacatggtgccatttaccaatgccttctt
ggcgaagacgcgcgcgaggtgtcgcgtttgtgggtgacggcatcgggcggccccttccgc
ggccgcacgcgcgacgagctggcgagcatcacacctgcccaggcgcttgcgcatcctacg
tggaacatgggtgcaaagatatccatcgattcgtccacactcatgaacaaggggcttgag
gttatcgaagcgcaccacctgtttgccatggactacgacaagatcagcgttgtcgtacag
ccgcagagtgccattcattcgatggtggaatttaccgacggcagcgtgaaagcgcacctc
ggcaccacagatatgcgcattcccattcagtttgcgctcagctatcccgagcgctggaac
gcgccggtcgaaccgcttgattttcgcacgctcggtacccttgagtttgccgcacccgat
gaagatacgtttcgttgtctcgccctcgcacgccatgcggggaaggtgggcggtacgctg
ccgtgcgtcatgaacgccgcgaacgaggtggccgtcgctgccttcttggcgaaagaggga
tcctacctcggcattgccgcctgtgtcgaagccgttatgaatgcccacgaacgtgccggt
gtccagcgggttgaaagtctcgaacagctcgaagaactcgatgcgtggtcgcgcaccgaa
gcgcgcaaaaacctccgatag

DBGET integrated database retrieval system