KEGG   Eggerthella sp. YY7918: EGYY_08160Help
Entry
EGYY_08160        CDS       T01566                                 

Gene name
RecR
Definition
recombinational DNA repair protein
Orthology
K06187  
recombination protein RecR
Organism
eyy  Eggerthella sp. YY7918
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:eyy03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
889029..889625
Genome map
AA seq 198 aa AA seqDB search
MYAAPSIQKLLDELERLPGVGPKSAQRIAYWILNTDKATALRLSEAIAEVKDQVHFCSRC
FNYAEDDLCDICRSSKRDTSIICVVSEPRDIPPIERTAVYSGVYHVLGGALSPMEGIGPD
NLHIAELMKRLASEEVTEVVLATNPNVEGETTAAYLARLIKPLGISVTRPASGLPVGGDL
EFADEVTLGRAIEARREL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcagcgccgtccattcaaaaactgcttgacgagcttgaacgccttccgggcgtt
gggccgaagtctgcccagcggatagcctattggatacttaataccgacaaggctacggcg
ttgcgtctgtccgaagctatcgccgaagttaaagaccaggtgcatttctgcagtcgctgc
tttaactacgccgaagacgatttgtgcgatatatgccgttcgtccaagcgtgatacgagc
attatctgcgtggtcagcgagccgcgcgatattccgcccatcgaacgcacggcggtctat
tcgggtgtctaccatgttctgggtggcgcactgtcgccgatggagggtatcggccccgac
aatttgcacattgcggagctcatgaagcgcctggcttccgaagaagtgaccgaggtggtg
ctggccacgaatcccaatgtggaaggggaaacgacggccgcttacctcgcgcgtctcatc
aagccgctgggtatttctgtcacgcgccccgcgagcggcctgcccgtaggcggcgatttg
gaatttgccgacgaagtcacgctcggacgcgccatcgaagcccgccgcgagctttag

DBGET integrated database retrieval system