KEGG   Eggerthella sp. YY7918: EGYY_09230Help
Entry
EGYY_09230        CDS       T01566                                 

Definition
hypothetical protein
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
eyy  Eggerthella sp. YY7918
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eyy00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    EGYY_09230
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    EGYY_09230
Enzymes [BR:eyy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     EGYY_09230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1014159..1014743
Genome map
AA seq 194 aa AA seqDB search
MQSVVSGNFTFTKTSIDGVIIVDVISYGDERGYFMETYKEPDFMKGGIDARFVQDNQSSS
TKGVLRGLHFQIEHPQAKLVRVISGEVFDVAVDLRKGSPTFGKWEGVVLSAENKRQFFIP
RGFAHGFLVLSDTAEFCYKCDDIYHPNDEGGLMWNDPAINIEWPALQGDDVFDESKVILS
KKDVEHAHLGNLAV
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgcagtctgtcgtttcggggaactttacttttaccaagacatctatcgacggcgtgatc
attgttgatgttatatcgtacggcgatgaacgtggctattttatggagacatataaggag
cctgatttcatgaagggtgggattgatgcacgctttgtgcaggataaccagtcctcttcg
acaaagggggttttacgcgggctccatttccaaattgagcacccacaggcaaaacttgtt
cgggtgatttcaggcgaagtgttcgatgtggcggttgacttgcgcaagggtagtcctacc
tttggtaaatgggaaggcgtggttttgtcggcggaaaataagcgtcagttttttattcct
cgcggcttcgcacatggctttttggtgctttctgatactgcagaattttgctacaagtgc
gatgatatataccaccccaatgatgagggcggtcttatgtggaacgaccccgcaattaat
attgagtggcccgccttgcaaggagacgatgtctttgacgaatcaaaggtcattctaagt
aagaaagatgtggaacatgcgcatctcggcaatctagctgtctag

  All links  
No link information was found.   
DBGET integrated database retrieval system