KEGG   Eggerthella sp. YY7918: EGYY_09540Help
Entry
EGYY_09540        CDS       T01566                                 

Gene name
MurE
Definition
UDP-N-acetylmuramyl tripeptide synthase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
eyy  Eggerthella sp. YY7918
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:eyy00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    EGYY_09540 (MurE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EGYY_09540 (MurE)
Enzymes [BR:eyy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     EGYY_09540 (MurE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1056958..1058463
Genome map
AA seq 501 aa AA seqDB search
MGKTCTELFAGLDCTIIGNADDEVSGIAYRSDRVQPGDAFFCIVGFTTDGHSFAQDAINR
GAKVLVVQRKVYLADATDVTEVVVSDTRKAMAHAAANFYDHPSCDFSLVGITGTNGKTTT
TYLVEHIARVAGKRTGVIGTVGVRIGDVQEKTAHTTPESPDLQQMFARMRDERCDVVAME
VSSHALDLERTWHTKFAVTAFSNLTQDHLDYHHTFEAYFEAKARLFSKDYPARRVICIDD
KWGRELLRRCSAAEDNIITTGFDTAAQIHPIEVNYAPTHTTVTLDVRGSRFSFDYPLVGK
FNVENIMCAFGIGLQLGYTPELIVRALGEAPQIPGRLERVSAAYDGGVSVFVDYAHTPDA
LEKALASIMALTPGRTICVFGCGGDRDASKRSIMGKAALSADHVVVTSDNPRTEDPLAII
DDIVSGMGFGAGRFDVEPDRRAAIARALSQAQAGDSVLIAGKGHEDYQLVGDQVLSFDDR
VVAAEELQRAFGESANEGDAD
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagacctgtactgaattattcgcgggactcgactgcaccatcatcggcaatgcc
gatgacgaagtgagcggcatcgcgtatcgcagcgaccgggtgcaacccggcgatgctttt
ttctgtattgttggctttacgaccgatggacactcgtttgcccaagatgctatcaatcgc
ggtgcaaaggtgctcgtcgtgcagcgcaaagtgtatctggctgatgccaccgatgtcacc
gaggtcgtggtttccgacacgcgcaaggcgatggcgcatgcggcggcgaacttctacgat
cacccttcatgcgatttttcgctggtgggtattacgggcacgaacggcaaaacgacgacg
acctatttggttgagcatattgcgcgcgtggcgggcaaacgcaccggcgttatcggcacc
gtgggtgtgcgtattggcgatgtgcaggaaaagacggcccacactacgcccgagtcgccc
gacctgcagcagatgttcgcgcgtatgcgtgacgagcgctgcgacgttgtggctatggag
gtgagttcgcatgcgcttgacctggagcgtacgtggcacaccaaatttgcggtgaccgcc
ttttcaaatctcacgcaagatcatttggattatcaccataccttcgaggcctactttgaa
gcgaaggcgcgactcttctcaaaagactatccggcgcgacgcgtcatctgcatcgacgat
aaatgggggcgcgaactgctccgtcgctgttcggccgctgaagacaatatcatcacaacc
ggtttcgatacggcggcgcaaattcatcctatcgaagtgaactatgctcccacgcatacg
acggtgacgcttgatgtgcgcggaagtcgtttttcattcgattatccgctcgtcggcaaa
ttcaacgttgaaaacatcatgtgcgcgttcggcatcgggcttcagttgggttatacgccc
gagcttatcgttcgggcacttggtgaggcgccgcagattcccggtcgtcttgagcgcgtg
agcgcggcgtacgatggaggcgtgagcgtgtttgtggattacgcgcatacgcctgacgct
ttggaaaaagcgctcgcgtccattatggcactgacgccgggacgtaccatctgcgtgttc
ggatgcggtggagatcgcgatgcgtcgaagcgctccatcatgggcaaagcggccctgtcg
gccgatcacgtggtggtgacaagcgataacccccgcacggaagatccgctagctattatc
gacgacatcgtaagcggcatgggctttggtgcgggccgtttcgacgtggaacccgatcgt
cgtgccgctatcgcacgtgcgctttcgcaggcgcaggcgggcgattcggtgctgattgcg
ggcaagggccacgaggattatcagctggtcggcgaccaggtgctctcgttcgatgatagg
gtggtggccgccgaagagctgcaacgcgcgttcggcgagtcggcaaacgaaggggacgca
gactag

DBGET integrated database retrieval system