KEGG   Eggerthella sp. YY7918: EGYY_10480Help
Entry
EGYY_10480        CDS       T01566                                 

Definition
hypothetical protein
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
eyy  Eggerthella sp. YY7918
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eyy00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    EGYY_10480
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EGYY_10480
Enzymes [BR:eyy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     EGYY_10480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1168303..1169589
Genome map
AA seq 428 aa AA seqDB search
MAEEIIIVQGNNTLSGEVAVSGAKNSALKLIAAAILGQGASSIHNVPLISDIEVMSEVLR
RLGATVTRDGHTLTVDTSAVNNHETPYELVSKMRASISVLGPLVGRFGCARVAMPGGCQI
GARKIDMHLVGLEALGVEFVIDHGFLEATTPNGLRGTHVVLDFPSVGATENLLMASVVAD
GRTIIENAACEPEIVDLVNMLVAMGAKVTGAGTSIIEVEGVSLDALHPCEHTTVGDRIEA
GTFLAGGALTGGPVTVRGIDPSYLRVALMKLQAMGCEIECGKDWITVRRSGKLVPIDIQT
LPHPGFPTDLQAQFMLLAACAEGMSVITENVFENRFMFASELMRMGADITIEDHHALVRG
VERLQGADVSSTDLRAGAAIVLAGIVAEGETRVHTIGHIDRGYEDYVGKLVSLGADVVRT
QINDTTTL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagagatcatcattgtgcagggcaacaacacgctttcgggtgaagttgccgtg
tcgggggcgaaaaactccgccctcaagcttattgccgcagctattttggggcaaggggca
tcgtctatccacaatgttccgctcatttccgacatcgaggtgatgtcggaagtgctgcgt
cgtttgggcgccacggtcacgcgcgacggccataccctgacggtggacacttccgcggtc
aacaaccatgagacgccctatgagctggtctctaagatgcgtgcgagcatatcggtgctc
ggaccgctggtagggcggtttggctgcgctcgtgtcgctatgccgggcgggtgccaaatc
ggtgcacgcaagatcgacatgcaccttgtgggtcttgaagctctgggcgttgaattcgtt
atcgaccacgggtttttggaggctacgacgcccaacgggctgcgcggtacgcacgtcgtg
ttggatttcccgagcgtgggtgcgacggagaacctgctcatggcatcggttgtggcagac
ggccgtactattatcgaaaatgcggcctgcgaacccgaaatcgtcgatctcgtgaacatg
ctggttgccatgggtgcgaaggtgacgggtgcaggaacgtccatcatcgaggttgagggc
gtttctcttgacgcgcttcatccctgcgaacacacaacggtgggcgatcgcattgaggcg
ggcacgtttcttgccggcggcgcgctgaccgggggaccggtgacggtgcgcggcatcgac
ccctcctatcttcgcgtggcgcttatgaagctgcaggcgatgggctgcgagattgaatgc
ggcaaggattggataaccgtacgccgaagcggcaagctggtacccattgatattcagacg
ctgccgcatcccggattccccaccgatttgcaggcgcagttcatgctgcttgcagcgtgc
gctgaggggatgtcggtcatcactgagaacgtgtttgaaaatcggttcatgtttgcgagc
gagctgatgcgcatgggcgccgatattaccatcgaagatcaccatgcgcttgtgcgtggc
gtcgagcgtttgcagggcgccgatgtttcttcgaccgacttgcgcgccggtgcggctatc
gtattggcgggcattgtcgccgagggcgagacgcgcgtgcacaccatcggccacatcgac
cgcggctacgaggattacgtgggcaagcttgtttcgcttggcgccgatgtcgtgcgtacc
caaattaacgatacaacgacgctctag

DBGET integrated database retrieval system