KEGG   Eggerthella sp. YY7918: EGYY_11150Help
Entry
EGYY_11150        CDS       T01566                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
eyy  Eggerthella sp. YY7918
Brite
Enzymes [BR:eyy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     EGYY_11150
Transfer RNA biogenesis [BR:eyy03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    EGYY_11150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1237677..1239503)
Genome map
AA seq 608 aa AA seqDB search
MDDIMREILEALRQGEGSGALDTLSLERIVRKHNEGRVQGMPRFAKKKLLPYYFKVRESN
RTLWENWHIDEALEKRLIKTLQVKPRRTASGVATITVITKPWPCSSNCLYCPNDLRMPKS
YLADEPACQRAEHNYFDPYLQVASRLHVLSQMGHVTDKIELIVLGGTWSDYPETYQTWFV
AELFRALNDASVGRAEENARTRRALYEQAGLSNDRDTLASLIREKQDAVVAGELTYNQAM
RQFYEESEGWRQVAVTQAATLDDVMRQQTTNESARHRAVGLVIETRPDAITPESLTLIRR
LGCTKVQMGIQSLDERILAMNNRAVSVQKIQEAFELLRLFGFKIHVHFMANLYGSTVEAD
KRDYLHLVTQAPYLPDEVKLYPCALVWGTGLIAHHQDGTWRPYTEEELLDVLVADVAATP
PFVRISRMIRDISAHDIVAGNKKVNLRQLVERTANDTHTPIKEIRYREISTDDADVETLA
LNIISYETTVSDEQFLQWVTPEGKIAGFLRLSLPKQDHVEQHRDSLPIAPGEAMIREVHI
YGKVAGLHTTGSGAQHLGLGKQLIQSACTIAFEEGFRTIHVISSVGTRAYYRALGFTDGD
LYQQKPLP
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggatgacatcatgcgggaaatacttgaagcgttgcgccagggcgaaggctctggtgcc
ctcgacaccctttctcttgaaagaatcgtgcgcaagcacaacgaaggccgcgtgcagggc
atgccccgcttcgcaaagaagaagctgctgccctattatttcaaggtgagggaaagcaac
cgcacactctgggaaaactggcatatcgacgaggcattggaaaagcgccttatcaaaacg
ctgcaggtcaaaccacgccgaacggcatcgggcgtggcaaccatcaccgtcatcaccaaa
ccgtggccatgttcgagcaattgcctctactgccccaacgacttgcgcatgcccaaaagc
tatcttgccgacgaaccggcctgccagcgcgccgagcataactatttcgacccctatctt
caggtggcatcgcgtctgcacgtgctttcgcagatgggtcacgtgaccgacaagattgaa
ctcatcgttttggggggcacgtggagcgattatcccgaaacgtaccagacgtggtttgtc
gcagagctcttccgtgcactcaacgacgccagcgtcggtcgggcagaagagaacgcccgc
acgcgtcgcgccctctatgagcaggcagggctcagcaacgaccgcgatacgcttgccagc
ctcatccgcgaaaagcaagatgcggtggtggcaggagagcttacctacaaccaagcgatg
cggcagttctacgaagaaagcgaaggctggcgccaggtcgcagtcacgcaggccgctacc
ctcgacgacgtgatgcgccagcaaaccaccaatgaaagcgcacgtcatcgcgcggtcggg
ctggtcatcgaaacccggcccgatgccatcacgcctgaaagcctgacgctcatcaggcgt
ttgggctgcaccaaggtacagatgggcatccaaagcctcgatgaacgcatcctagccatg
aacaaccgcgccgtgagcgtgcaaaagatccaggaagcgtttgagttgctgcgtctattc
ggcttcaagattcacgtacactttatggcgaacctgtacggatcgacggtcgaagcggac
aagcgcgactacctacatctggttacgcaagcgccctaccttcccgacgaagttaaactc
tacccgtgcgcgcttgtgtggggaacggggcttatcgcccatcaccaggacggaacctgg
cggccgtataccgaagaagagctgcttgacgtgcttgtggccgatgtcgccgccacgccg
ccgtttgttcgtatatcgcgcatgatcagggatatctcggcccacgatatcgttgccggc
aacaagaaggtcaacctacgccagctggttgaacgcaccgccaacgatacccacacgccc
atcaaagaaatccgctaccgcgagattagcaccgacgacgcagacgttgaaacgctggcg
ctgaatatcatctcctacgaaacgaccgtttccgacgagcagtttcttcagtgggttacc
cccgaaggcaaaatcgcaggctttttgcggctttcgctgccgaagcaagaccacgtcgaa
caacatcgggattctttgcccatcgctcccggtgaagccatgattcgcgaagttcatatc
tacggaaaagttgccggcttgcacacgaccggatcgggtgcgcagcatcttggactgggc
aaacagctgatacagtccgcctgcaccatcgccttcgaagaaggctttcgaaccatacat
gtcatcagctcggtcggcacccgcgcttactatcgcgctcttggttttaccgatggcgac
ctttaccagcagaaaccgcttccctaa

DBGET integrated database retrieval system