KEGG   Eggerthella sp. YY7918: EGYY_12920Help
Entry
EGYY_12920        CDS       T01566                                 

Gene name
TpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
eyy  Eggerthella sp. YY7918
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:eyy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EGYY_12920 (TpiA)
   01230 Biosynthesis of amino acids
    EGYY_12920 (TpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EGYY_12920 (TpiA)
   00051 Fructose and mannose metabolism
    EGYY_12920 (TpiA)
   00562 Inositol phosphate metabolism
    EGYY_12920 (TpiA)
Enzymes [BR:eyy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     EGYY_12920 (TpiA)
Exosome [BR:eyy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   EGYY_12920 (TpiA)
  Exosomal proteins of bladder cancer cells
   EGYY_12920 (TpiA)
  Exosomal proteins of melanoma cells
   EGYY_12920 (TpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1418477..1419244
Genome map
AA seq 255 aa AA seqDB search
MRKPMMAGNWKMNNTVAEAVVLTQELSNRYTDAWADRADVVICPPFVDLKPAKTVLEFDK
TRIAIGAQDVYWEPKGAFTGEISVPMIKEIGCTYCIVGHSERRELFGETNEDVNRKAKAL
IAGGLAPIVCVGESLAVRDEGTTNEYVCAQVRAAFAGIDATDAKVCVVAYEPIWAIGTGR
TATPEQAEAVCAAIRATLAELYGADVSEAMRVLYGGSMNPGNVEGLMAQPNIDGGLVGGA
SLDATSFAELVKACL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacccatgatggcgggtaactggaagatgaacaacacggttgcagaagcggtg
gtgttaacccaggagctttctaatcgctacaccgacgcgtgggccgatcgcgccgacgta
gtcatctgccctccttttgttgacctcaagccggccaagacggtacttgaattcgacaag
acaagaatcgccatcggcgcacaggatgtgtactgggagccgaagggtgcgtttacgggc
gagatttcggttcctatgatcaaagagatcggctgcacgtattgcatcgtggggcattcg
gagcgtcgcgagctgtttggtgaaacgaatgaggacgtgaatcgcaaggcgaaggccttg
atcgcgggtggtttggctccgatcgtttgtgtgggcgaatcgcttgcggtgcgtgatgag
gggactacgaacgagtatgtgtgcgctcaggtacgtgccgcttttgcaggcatcgacgcg
accgatgcaaaggtatgtgtcgttgcctacgaacccatttgggcgatcggcaccggacgc
acggctacgcctgagcaggctgaagcggtgtgcgccgccatccgcgcaacgcttgcggaa
ctctatggcgctgatgtatccgaagctatgcgtgtgctgtacggcggatcgatgaatccg
ggcaacgtggaaggcctcatggcgcaaccaaatatcgacggcggtctggtcggcggtgcg
agtctcgatgccacctcattcgctgagctggtaaaggcatgcctgtaa

DBGET integrated database retrieval system