KEGG   Eggerthella sp. YY7918: EGYY_13450Help
Entry
EGYY_13450        CDS       T01566                                 

Definition
hypothetical protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
eyy  Eggerthella sp. YY7918
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:eyy01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:eyy00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:eyy00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:eyy00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:eyy00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1469324..1471105
Genome map
AA seq 593 aa AA seqDB search
MRNINLRFVTETYNEAGLLSDFAVNCPENFNFGYDVVDDIAVADPDRRAMVWCNPEGEEH
VFTFADMKKWSDKTANFLAEAGIGRGDMVMVILRRHYQFWFVATALAKLGAVMVPATFML
KEHDLEYRLNGASIKAIIATSLGTIADVVDNVADECPTLETRILVNGAGGGLTPEDENGN
LVFPDDGLPLGEMLSGPDGICAAPAERAGWLDFNTGVRAASADFTRRATAAADPMLMYFS
SGTSGNPKMVLHDSEYAIAHLVTAKHWHNVDPEGLHFTIADTGWGKAVWGKYYGQWLMEA
CVFTYDFDRFHPSEILSLIGKYRITTLCCPPTMYRMMMAEDVDAYDLTLLVYSTTAGEAL
NPDLFDFWKEHTGLTIYEGFGQTETPLTIANLTGSTPRPGSMGKPVPLYNVEIQRADGSR
CDTGETGEVCIDIHQKAAGIMLEYYRDPAKTEAAMYDGWYHTGDMAWCDEDGYFWYVGRN
DDVIKSSGYRIGPFEIESVLLEHEAVRECAVTGVPDPVRGKAVKATIVLTDGFTGSTELT
RELQTWVKKRTAPYKYPRIVEYVDELPKTVNGKIRRAAIREVDEAEKAPEGLL
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgagaaacatcaatcttcgcttcgttaccgaaacatacaacgaggcaggtcttttgagt
gactttgctgtcaactgccccgagaatttcaactttggctacgacgtggtggacgacatt
gccgtcgccgaccccgatcgccgcgccatggtgtggtgcaatcccgagggggaggagcac
gtctttacgtttgccgacatgaagaaatggtcggacaagacagcgaactttttggctgag
gcgggcattgggcgcggcgacatggtcatggtcatcctgcgccgccactatcagttctgg
tttgtggcgaccgcgcttgcaaagctcggcgcggttatggtgccggctacctttatgctg
aaggaacacgatctggaatatcgtttgaacggcgcctcaattaaggctatcatcgccacc
tcgcttggcactattgccgatgtggtggacaatgtggcggacgagtgccccacgcttgag
acgcgcatcctggtgaacggcgcgggtggcggtcttacgcctgaggacgagaacggcaac
ctggtgtttcccgacgacggcttaccgctgggcgagatgctttctggtccggacggcatc
tgcgccgctcccgccgagcgcgcaggttggctcgacttcaacaccggtgtgcgtgcggca
tcggcggactttacgcgacgggcgacggcggctgccgaccccatgctcatgtacttctcg
tccggtacgtcgggcaaccccaagatggtactgcacgactccgaatacgccattgcgcac
ctggtcaccgccaagcactggcacaacgtggatccggaaggcttgcatttcaccatcgct
gacaccggctggggcaaggctgtgtggggcaagtactacggccagtggctcatggaggca
tgcgtgttcacctacgacttcgaccgcttccatccctccgagattctctcgctcatcggg
aagtaccgcatcacgacgctgtgctgtccgcccacgatgtatcgcatgatgatggccgag
gatgtggacgcatacgacctcacgttgctcgtgtactccaccacggcgggcgaagcgctg
aatcccgacctgttcgatttctggaaggaacacacggggcttaccatctacgagggcttc
ggccagaccgagacgccgcttaccattgcgaacctgactggttccacgccgcgtcccggt
tcgatgggcaagccggtgccgctgtacaacgtggaaattcagcgggccgacggcagtcgc
tgcgacacgggcgagacgggcgaggtgtgcatcgacattcatcagaaggctgcgggcatc
atgctggaatactatcgcgacccggctaagactgaggctgccatgtatgacggctggtat
cacaccggagatatggcctggtgcgatgaggatggttacttctggtacgtgggtcgcaac
gacgacgttatcaagtcaagcggctatcgcatcggccccttcgagattgagagcgtgctt
ttggaacatgaggccgtgcgcgagtgcgcagtcacgggcgtgcccgatccagtgcgtggc
aaggctgtgaaggcgaccatcgtgcttacggacggatttacgggttcgaccgagctcacg
cgtgagctacagacttgggtgaaaaagcgcacggctccgtataaatatccccgtatcgtc
gagtacgtggatgaactgcccaaaaccgtgaacggcaagattcgtcgcgccgccattcgc
gaggtggacgaagctgaaaaagcgcccgagggattgctttga

DBGET integrated database retrieval system