KEGG   Eggerthella sp. YY7918: EGYY_13450Help
Entry
EGYY_13450        CDS       T01566                                 

Definition
hypothetical protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
eyy  Eggerthella sp. YY7918
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eyy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EGYY_13450
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EGYY_13450
   00620 Pyruvate metabolism
    EGYY_13450
   00640 Propanoate metabolism
    EGYY_13450
  Energy metabolism
   00680 Methane metabolism
    EGYY_13450
Enzymes [BR:eyy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     EGYY_13450
Lipid biosynthesis proteins [BR:eyy01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   EGYY_13450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1469324..1471105
Genome map
AA seq 593 aa AA seqDB search
MRNINLRFVTETYNEAGLLSDFAVNCPENFNFGYDVVDDIAVADPDRRAMVWCNPEGEEH
VFTFADMKKWSDKTANFLAEAGIGRGDMVMVILRRHYQFWFVATALAKLGAVMVPATFML
KEHDLEYRLNGASIKAIIATSLGTIADVVDNVADECPTLETRILVNGAGGGLTPEDENGN
LVFPDDGLPLGEMLSGPDGICAAPAERAGWLDFNTGVRAASADFTRRATAAADPMLMYFS
SGTSGNPKMVLHDSEYAIAHLVTAKHWHNVDPEGLHFTIADTGWGKAVWGKYYGQWLMEA
CVFTYDFDRFHPSEILSLIGKYRITTLCCPPTMYRMMMAEDVDAYDLTLLVYSTTAGEAL
NPDLFDFWKEHTGLTIYEGFGQTETPLTIANLTGSTPRPGSMGKPVPLYNVEIQRADGSR
CDTGETGEVCIDIHQKAAGIMLEYYRDPAKTEAAMYDGWYHTGDMAWCDEDGYFWYVGRN
DDVIKSSGYRIGPFEIESVLLEHEAVRECAVTGVPDPVRGKAVKATIVLTDGFTGSTELT
RELQTWVKKRTAPYKYPRIVEYVDELPKTVNGKIRRAAIREVDEAEKAPEGLL
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgagaaacatcaatcttcgcttcgttaccgaaacatacaacgaggcaggtcttttgagt
gactttgctgtcaactgccccgagaatttcaactttggctacgacgtggtggacgacatt
gccgtcgccgaccccgatcgccgcgccatggtgtggtgcaatcccgagggggaggagcac
gtctttacgtttgccgacatgaagaaatggtcggacaagacagcgaactttttggctgag
gcgggcattgggcgcggcgacatggtcatggtcatcctgcgccgccactatcagttctgg
tttgtggcgaccgcgcttgcaaagctcggcgcggttatggtgccggctacctttatgctg
aaggaacacgatctggaatatcgtttgaacggcgcctcaattaaggctatcatcgccacc
tcgcttggcactattgccgatgtggtggacaatgtggcggacgagtgccccacgcttgag
acgcgcatcctggtgaacggcgcgggtggcggtcttacgcctgaggacgagaacggcaac
ctggtgtttcccgacgacggcttaccgctgggcgagatgctttctggtccggacggcatc
tgcgccgctcccgccgagcgcgcaggttggctcgacttcaacaccggtgtgcgtgcggca
tcggcggactttacgcgacgggcgacggcggctgccgaccccatgctcatgtacttctcg
tccggtacgtcgggcaaccccaagatggtactgcacgactccgaatacgccattgcgcac
ctggtcaccgccaagcactggcacaacgtggatccggaaggcttgcatttcaccatcgct
gacaccggctggggcaaggctgtgtggggcaagtactacggccagtggctcatggaggca
tgcgtgttcacctacgacttcgaccgcttccatccctccgagattctctcgctcatcggg
aagtaccgcatcacgacgctgtgctgtccgcccacgatgtatcgcatgatgatggccgag
gatgtggacgcatacgacctcacgttgctcgtgtactccaccacggcgggcgaagcgctg
aatcccgacctgttcgatttctggaaggaacacacggggcttaccatctacgagggcttc
ggccagaccgagacgccgcttaccattgcgaacctgactggttccacgccgcgtcccggt
tcgatgggcaagccggtgccgctgtacaacgtggaaattcagcgggccgacggcagtcgc
tgcgacacgggcgagacgggcgaggtgtgcatcgacattcatcagaaggctgcgggcatc
atgctggaatactatcgcgacccggctaagactgaggctgccatgtatgacggctggtat
cacaccggagatatggcctggtgcgatgaggatggttacttctggtacgtgggtcgcaac
gacgacgttatcaagtcaagcggctatcgcatcggccccttcgagattgagagcgtgctt
ttggaacatgaggccgtgcgcgagtgcgcagtcacgggcgtgcccgatccagtgcgtggc
aaggctgtgaaggcgaccatcgtgcttacggacggatttacgggttcgaccgagctcacg
cgtgagctacagacttgggtgaaaaagcgcacggctccgtataaatatccccgtatcgtc
gagtacgtggatgaactgcccaaaaccgtgaacggcaagattcgtcgcgccgccattcgc
gaggtggacgaagctgaaaaagcgcccgagggattgctttga

DBGET integrated database retrieval system