KEGG   Eggerthella sp. YY7918: EGYY_14520Help
Entry
EGYY_14520        CDS       T01566                                 

Gene name
Gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
eyy  Eggerthella sp. YY7918
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:eyy00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    EGYY_14520 (Gmk)
Enzymes [BR:eyy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     EGYY_14520 (Gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1577747..1578319)
Genome map
AA seq 190 aa AA seqDB search
MRHGNLFVISGPSGAGKGTLVARLMHDVPDTWVSRSVTTRLPRAGEVDGVQYRFLSDSEF
QDLVESDGLLEWATYGGNRYGTPRATVEEHIANGDQVILEIDVQGAFQVREKLPSAHLIF
IEPPSLAVLEARLRGRGTETDEQIAARMEAAKVELSRKMEYDIRLVNDDLEEAACALAAY
VNEQAEKIRG
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcacggaaatctgtttgtgatttcagggccatcaggtgccggtaaaggcacgctg
gtggcccgtcttatgcatgatgtacccgatacgtgggtttctcgttcggtgaccactcga
ctgccgcgcgccggtgaagtggatggcgtgcagtaccggtttctttccgatagtgagttt
caggacttggtggaaagtgatggattgttggaatgggctacctacgggggtaatcggtat
gggacacctcgcgcgaccgttgaagagcatatcgccaacggtgaccaggtaattctggag
attgacgttcagggtgcgtttcaagtgcgcgaaaaactcccctcagctcatttgattttc
atcgaacctccttcgcttgccgtgcttgaggcgcgtttgcgcggacgtggcaccgagacc
gatgaacaaatagcggctcgtatggaggctgcaaaggtggagctttcccgtaaaatggag
tatgatatacggcttgtgaacgacgatttagaagaagctgcctgtgctttggcagcgtat
gtaaacgaacaagccgagaaaatacgaggttga

DBGET integrated database retrieval system