KEGG   Eggerthella sp. YY7918: EGYY_14710Help
Entry
EGYY_14710        CDS       T01566                                 

Definition
hypothetical protein
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
eyy  Eggerthella sp. YY7918
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eyy00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    EGYY_14710
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EGYY_14710
Enzymes [BR:eyy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     EGYY_14710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1595790..1596734)
Genome map
AA seq 314 aa AA seqDB search
MAFNHKHLIDITEYSADDIMTVLETATRFKEVNERRIKQVPTLKGVTVVNMFNEPSTRTR
SSFEIAEKRLSANSLNFGGSSTSLVKGESLVDTVETLCAYKIDMIIVRDKHAGVPRLIAD
VSGAHVIDAGDGKHQHPTQALLDLYSIWEVKGDLNGLKVGVVGDIGHSRVCGSLIPALKI
MGCEVTVIAPPTLLPARPDVLGADHVTTKLDEVLPDLDVVYMLRIQRERLEGAPYPSLRE
YNMLYGLTKEREPLMKPDALICHPGPINRGVELDSYMADHPKRSVILDQVYAGILTRMAE
MYLLLGGSEDGLTA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggctttcaaccacaaacacctcatcgatatcacggagtattccgctgatgacatcatg
acagttcttgagacggccacccgattcaaggaagtcaacgagcgtcgcatcaagcaagtt
cctaccttgaagggtgtcacggtggtgaacatgttcaacgagccgtccacgcgtacgcgc
tcgtcgttcgagatcgccgaaaagcgtctttccgcgaacagcctgaacttcggtggcagc
tctacctccttggtgaagggcgagagcctcgtggacacggtggagacgctctgtgcttac
aagattgatatgattatcgtacgtgacaagcacgcgggcgtgccgcgcctcatcgccgac
gtatccggcgcgcatgtgatcgatgcgggtgacggcaagcatcagcacccgacgcaggct
ctgctcgacctgtactccatctgggaagtcaagggcgacctcaacggcctcaaggtgggc
gtggtgggcgacatcggccactctcgtgtgtgtggcagcctgatcccggcactcaagatc
atgggctgtgaggtaacggttatcgcgccgcctacgctgcttcctgcgcgtcccgacgtt
ttgggcgccgatcatgtgaccacgaagcttgacgaagtgcttcccgacctggatgtggtg
tacatgctgcgcattcagcgcgagcgtctggaaggtgcgccgtaccccagcctgcgtgag
tacaacatgctctacggtcttacgaaggagcgcgagccgctcatgaagcccgatgccctc
atctgtcatcccggccccatcaaccgcggcgtcgaactggacagctacatggccgatcac
ccgaagcgctcggtcattctcgatcaggtctatgcgggcatcttgacccgcatggccgaa
atgtacctgctgcttggagggagcgaagatggccttactgcttaa

DBGET integrated database retrieval system