KEGG   Eggerthella sp. YY7918: EGYY_19130Help
Entry
EGYY_19130        CDS       T01566                                 

Gene name
FrvX
Definition
(GenBank) cellulase M
Organism
eyy  Eggerthella sp. YY7918
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2080700..2081881)
Genome map
AA seq 393 aa AA seqDB search
MKHKQVKFLKRLLETPSPTGTEAAVAEVVRTRLADVADEIQTDVMGSVHARLAGRASGPS
FMLSAHMDEIGLMVTYISDEGFLSVAAVGGVDAAILPGLRVDVHASGCEEPLRGVVGRKP
IHLISPDDRKSVTPIDQLVIDLGLPAKKVKKVVQIGDVITFGVGFERFGKNMAVSRAFDD
KAGVWVAVRVLEELAKAGRAPGDFIAAATVQEEIGTRGATTSAYGVAPDVAVAFDVTHAT
DYPGIDKTKHGKFVCGEGPVIARGPNINPEVFDRLVAAAEAEGLPYQVEAEPGVTGTDAR
AIQITRSGIPTGLVSVPLRYMHTPTEVVCLDDLDATVCMLVRFALDLDENACFVPGMGVM
YDDLAGDSDASATFEAAEASSDSQAGVTETAEK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacaagcaggtcaaatttctcaagcgattgcttgaaacgccgtctcctacgggc
accgaagccgcggtggcagaggttgtgcgtactcgcttggcagacgttgccgacgagatt
caaaccgatgtcatgggctcggttcacgcgcggcttgccggacgcgcctcgggtccgtcg
ttcatgctctcggcccacatggacgagatcggacttatggtcacctacatttctgacgaa
gggttcctttcagtggctgcagtgggcggagtcgatgccgctattttgccggggctgcgc
gttgatgtgcacgcgtccggatgcgaagagccgctgaggggtgttgtaggccgcaagccc
attcacctgatcagccctgatgatcgcaagagcgtgacgcctattgaccagcttgtgatc
gacttgggccttcctgccaaaaaggtgaagaaagttgtgcaaatcggtgatgttatcacg
tttggtgtgggttttgagcgtttcggtaagaacatggctgtgtcgcgtgcgtttgacgac
aaggcgggcgtatgggtagctgtgcgcgtgcttgaggagctggcgaaggcggggcgcgct
ccgggggattttatcgcggccgcaacggtgcaggaagaaattggcacgcgcggtgcgacc
acttctgcctatggagtggcacccgacgtagcggtggcgtttgacgtgacgcacgctacc
gattatcccggcatcgataagacgaagcatggcaagtttgtctgcggcgaaggtcctgtc
atcgcgcgcggccccaatatcaatcccgaagtgtttgaccgtttggtggccgcggccgag
gctgaaggcctgccgtatcaggtggaggctgagccgggtgtgaccggcaccgacgcgcgt
gccatccaaattacgcgcagcggtattcccacgggtcttgtctccgtgccgctgcggtat
atgcacacgcctacggaagtggtatgccttgatgatctggatgcgaccgtgtgcatgctt
gtacggtttgctctcgacctagatgaaaacgcctgctttgtgccaggcatgggcgtaatg
tacgatgatctggccggcgacagcgatgcttcagcgactttcgaagcagctgaggcctct
tcagattcgcaggctggcgtaaccgagactgcggagaaatag

DBGET integrated database retrieval system