KEGG   Eggerthella sp. YY7918: EGYY_19130Help
Entry
EGYY_19130        CDS       T01566                                 

Gene name
FrvX
Definition
cellulase M
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
eyy  Eggerthella sp. YY7918
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eyy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EGYY_19130 (FrvX)
Enzymes [BR:eyy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     EGYY_19130 (FrvX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2080700..2081881)
Genome map
AA seq 393 aa AA seqDB search
MKHKQVKFLKRLLETPSPTGTEAAVAEVVRTRLADVADEIQTDVMGSVHARLAGRASGPS
FMLSAHMDEIGLMVTYISDEGFLSVAAVGGVDAAILPGLRVDVHASGCEEPLRGVVGRKP
IHLISPDDRKSVTPIDQLVIDLGLPAKKVKKVVQIGDVITFGVGFERFGKNMAVSRAFDD
KAGVWVAVRVLEELAKAGRAPGDFIAAATVQEEIGTRGATTSAYGVAPDVAVAFDVTHAT
DYPGIDKTKHGKFVCGEGPVIARGPNINPEVFDRLVAAAEAEGLPYQVEAEPGVTGTDAR
AIQITRSGIPTGLVSVPLRYMHTPTEVVCLDDLDATVCMLVRFALDLDENACFVPGMGVM
YDDLAGDSDASATFEAAEASSDSQAGVTETAEK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacaagcaggtcaaatttctcaagcgattgcttgaaacgccgtctcctacgggc
accgaagccgcggtggcagaggttgtgcgtactcgcttggcagacgttgccgacgagatt
caaaccgatgtcatgggctcggttcacgcgcggcttgccggacgcgcctcgggtccgtcg
ttcatgctctcggcccacatggacgagatcggacttatggtcacctacatttctgacgaa
gggttcctttcagtggctgcagtgggcggagtcgatgccgctattttgccggggctgcgc
gttgatgtgcacgcgtccggatgcgaagagccgctgaggggtgttgtaggccgcaagccc
attcacctgatcagccctgatgatcgcaagagcgtgacgcctattgaccagcttgtgatc
gacttgggccttcctgccaaaaaggtgaagaaagttgtgcaaatcggtgatgttatcacg
tttggtgtgggttttgagcgtttcggtaagaacatggctgtgtcgcgtgcgtttgacgac
aaggcgggcgtatgggtagctgtgcgcgtgcttgaggagctggcgaaggcggggcgcgct
ccgggggattttatcgcggccgcaacggtgcaggaagaaattggcacgcgcggtgcgacc
acttctgcctatggagtggcacccgacgtagcggtggcgtttgacgtgacgcacgctacc
gattatcccggcatcgataagacgaagcatggcaagtttgtctgcggcgaaggtcctgtc
atcgcgcgcggccccaatatcaatcccgaagtgtttgaccgtttggtggccgcggccgag
gctgaaggcctgccgtatcaggtggaggctgagccgggtgtgaccggcaccgacgcgcgt
gccatccaaattacgcgcagcggtattcccacgggtcttgtctccgtgccgctgcggtat
atgcacacgcctacggaagtggtatgccttgatgatctggatgcgaccgtgtgcatgctt
gtacggtttgctctcgacctagatgaaaacgcctgctttgtgccaggcatgggcgtaatg
tacgatgatctggccggcgacagcgatgcttcagcgactttcgaagcagctgaggcctct
tcagattcgcaggctggcgtaaccgagactgcggagaaatag

DBGET integrated database retrieval system