KEGG   Eggerthella sp. YY7918: EGYY_19890Help
Entry
EGYY_19890        CDS       T01566                                 

Gene name
FolA
Definition
dihydrofolate reductase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
eyy  Eggerthella sp. YY7918
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:eyy01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:eyy00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2131764..2132912)
Genome map
AA seq 382 aa AA seqDB search
MTKFTGSTHGEGARRLVIKIGSSTLTTSESGIDYDYLARIADQIARVRAAGWRPIVVTSA
AIACGLEKLGIEKRPHDMPSLQAAASVGQSALSTAYAEAFAAHDIVTSTVLLTRRDTADR
SAYLHARDTFDRLLDLGVVPIVNENDTVSVEQIRFGDNDTLAALVACLVEADLMVILSDI
EGLYDANPHTHPEARLISRVDAIDPAIMAVAGEAGSTVGSGGMITKIKAARVLMVAGIPM
VICDGRRADAIVDAAAGKDVGTLFVAAQKPHEITPKKLWIALGDAARGALIVDDGAKAAL
VSKGSSLLPVGVKAVEGRFEADDVVDIKDGTGHIFARGKVAAAIDEVQLACGLSREELQA
NRLLAHLTEKPLVHRDELVVFE
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaagtttacgggttctacgcacggggagggcgcgcggcgtctcgtgattaaaata
gggtcgtcaacgcttaccacgtcggagagcgggatcgactacgactatcttgcgcgcatt
gccgatcagattgcacgcgtccgtgcggcggggtggcggccgattgtggtcacctcggcg
gccatcgcgtgcgggcttgagaagctggggatcgagaagcgcccccacgatatgccgagt
cttcaggcggcggcatcggtggggcagagcgcactttcaaccgcctatgcagaagcgttt
gctgcgcacgatattgtgacttcgacggtgctgctcactcggcgcgatacggccgatcga
tcggcctatttgcatgcgcgtgatacgtttgatcggctgcttgatttgggcgtggtgcct
atcgtgaacgaaaacgatacggtatcggtcgagcagattcgctttggtgacaacgatacg
ttggctgcgcttgtggcgtgcttggtagaggccgaccttatggtaatcctttcggatatc
gaggggctctacgatgccaacccgcatacccatcccgaggcgcgtcttatcagccgggtg
gatgccatcgatcctgccattatggcagtggcgggcgaagcgggcagcacggtcggctcc
ggtggtatgattacgaagatcaaggcggcgcgcgtccttatggtggcgggtattccgatg
gttatctgcgacggacgacgcgcggacgcgattgtggacgcggcggccggcaaggacgtg
ggaactctcttcgtcgccgcgcaaaagcctcatgaaatcacgccgaagaagctgtggatt
gctcttggcgatgccgcccgtggcgcgctcattgtggatgacggcgcgaaggccgcgctt
gtaagtaagggtagttctcttctgccggtgggcgtgaaggcggttgagggtcgctttgag
gccgatgacgttgtggacatcaaggacggtaccgggcacatatttgcgcgcggtaaagtg
gctgcggcgattgacgaggtgcagcttgcgtgcggcctttctcgtgaggagttgcaggca
aaccgcctgcttgcgcatttgacggagaagccgcttgtgcatcgtgacgagcttgttgtt
tttgagtga

DBGET integrated database retrieval system