KEGG   Eggerthella sp. YY7918: EGYY_19890Help
Entry
EGYY_19890        CDS       T01566                                 

Gene name
FolA
Definition
dihydrofolate reductase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
eyy  Eggerthella sp. YY7918
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:eyy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    EGYY_19890 (FolA)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    EGYY_19890 (FolA)
Enzymes [BR:eyy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     EGYY_19890 (FolA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2131764..2132912)
Genome map
AA seq 382 aa AA seqDB search
MTKFTGSTHGEGARRLVIKIGSSTLTTSESGIDYDYLARIADQIARVRAAGWRPIVVTSA
AIACGLEKLGIEKRPHDMPSLQAAASVGQSALSTAYAEAFAAHDIVTSTVLLTRRDTADR
SAYLHARDTFDRLLDLGVVPIVNENDTVSVEQIRFGDNDTLAALVACLVEADLMVILSDI
EGLYDANPHTHPEARLISRVDAIDPAIMAVAGEAGSTVGSGGMITKIKAARVLMVAGIPM
VICDGRRADAIVDAAAGKDVGTLFVAAQKPHEITPKKLWIALGDAARGALIVDDGAKAAL
VSKGSSLLPVGVKAVEGRFEADDVVDIKDGTGHIFARGKVAAAIDEVQLACGLSREELQA
NRLLAHLTEKPLVHRDELVVFE
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaagtttacgggttctacgcacggggagggcgcgcggcgtctcgtgattaaaata
gggtcgtcaacgcttaccacgtcggagagcgggatcgactacgactatcttgcgcgcatt
gccgatcagattgcacgcgtccgtgcggcggggtggcggccgattgtggtcacctcggcg
gccatcgcgtgcgggcttgagaagctggggatcgagaagcgcccccacgatatgccgagt
cttcaggcggcggcatcggtggggcagagcgcactttcaaccgcctatgcagaagcgttt
gctgcgcacgatattgtgacttcgacggtgctgctcactcggcgcgatacggccgatcga
tcggcctatttgcatgcgcgtgatacgtttgatcggctgcttgatttgggcgtggtgcct
atcgtgaacgaaaacgatacggtatcggtcgagcagattcgctttggtgacaacgatacg
ttggctgcgcttgtggcgtgcttggtagaggccgaccttatggtaatcctttcggatatc
gaggggctctacgatgccaacccgcatacccatcccgaggcgcgtcttatcagccgggtg
gatgccatcgatcctgccattatggcagtggcgggcgaagcgggcagcacggtcggctcc
ggtggtatgattacgaagatcaaggcggcgcgcgtccttatggtggcgggtattccgatg
gttatctgcgacggacgacgcgcggacgcgattgtggacgcggcggccggcaaggacgtg
ggaactctcttcgtcgccgcgcaaaagcctcatgaaatcacgccgaagaagctgtggatt
gctcttggcgatgccgcccgtggcgcgctcattgtggatgacggcgcgaaggccgcgctt
gtaagtaagggtagttctcttctgccggtgggcgtgaaggcggttgagggtcgctttgag
gccgatgacgttgtggacatcaaggacggtaccgggcacatatttgcgcgcggtaaagtg
gctgcggcgattgacgaggtgcagcttgcgtgcggcctttctcgtgaggagttgcaggca
aaccgcctgcttgcgcatttgacggagaagccgcttgtgcatcgtgacgagcttgttgtt
tttgagtga

DBGET integrated database retrieval system