KEGG   Eggerthella sp. YY7918: EGYY_20080Help
Entry
EGYY_20080        CDS       T01566                                 

Gene name
HisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
eyy  Eggerthella sp. YY7918
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:eyy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    EGYY_20080 (HisD)
  Amino acid metabolism
   00340 Histidine metabolism
    EGYY_20080 (HisD)
Enzymes [BR:eyy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     EGYY_20080 (HisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2154097..2155458)
Genome map
AA seq 453 aa AA seqDB search
MRRVILTSGEVFSNTHLKRTGAFNAEALTAATAIIEDVCERGDAALREYTEKFDGVRLDD
FRVPQLAIDEAVAYVDDKTVKALRQAADQIRDFHERQRQQSWFTVREDGALVGSKVEPLE
SVGIYVPGGRALYPSTVLMNALPAAVAGVPRIVCVTPPAASGKLDPAILYACKLAGVTEI
YAVGGAQAVAALAYGTETIEPVTKITGPGNAYVAAAKKVVSGDVGIDMIAGPSEVCVVAD
ATADPALVAIDLMAQAEHDPLASCYLITFDSAYADEVERAVEVHLKSSTRAEITAASLAD
QGLVVVCNDIPQALEAVNVIAPEHLELHLDHAFDLLGAIRNAGAIFLGAWTPEAVGDYVA
GPNHTLPTGGTARYASPLSVDEFVKKSSVIQYSSAALARDADAVVTIARHEGLWAHAMSV
EMRQNLLRTGTVFGDGGASGSEVSPVAGGGRDE
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgtgtcatccttacatccggcgaggttttctcgaacacacacctcaagcgtaca
ggggcgtttaacgccgaagcgcttacggcggccacggccattatcgaagacgtttgcgag
cgcggcgatgcggcattgcgggaatacaccgagaagttcgacggcgtgcgcttggacgac
tttcgcgtgccgcagcttgccatcgacgaagccgtcgcctatgtggatgacaaaacggtc
aaggctctgcgtcaggcggccgatcaaattcgcgatttccacgagcgtcagcgccagcaa
agctggtttacggtgcgcgaagacggcgcgttggtgggaagcaaggtggagccgctggag
tctgtcggcatctacgtgccggggggacgtgcgctctatccatccaccgttctgatgaat
gccctgcccgccgccgtcgctggcgtgccgcgtatcgtgtgcgtaacgccgccggccgca
tccggcaagctcgatccggccattctgtatgcgtgcaagctggcgggagtgaccgaaatc
tatgccgtgggcggcgcccaggcggtggcggcgcttgcgtacggcacggaaaccatcgaa
cctgtgaccaagattaccggccccggcaacgcctatgtggccgccgcgaagaaggtggtg
tcgggcgacgtgggtatcgacatgatcgcgggtccttccgaggtgtgcgtggttgccgac
gcgacggccgatccggcacttgttgccatcgacctcatggcgcaggccgagcatgacccg
ctggcgtcgtgctatctgatcacgttcgattcggcctatgccgatgaggtagagcgtgcg
gttgaggtgcatctgaagtcgtcgacgcgcgcggagatcactgcagcctccctcgccgat
caggggcttgtggtggtgtgcaacgacatccctcaagcgctggaagcggtaaacgtcatt
gcgcccgaacatctggaactgcatcttgaccacgcctttgaccttttgggtgccattcgt
aatgcgggggctatcttcttgggcgcctggacgcccgaggcggtgggcgactacgtggcg
ggccccaatcacacgctgcccaccggcggtacggcgcgctacgcgtctccgctttccgtg
gatgaattcgtgaagaaatcgagcgtcattcagtactcctcagcggcgctcgcgcgcgat
gcggacgcggtggttaccatcgcgcgccatgagggcctttgggcacacgccatgagcgtg
gagatgcgccagaatctgttgcgcaccggtacggtgtttggggatggcggcgcatcaggc
agtgaggtatctcccgttgcgggtggcggtcgcgatgaatag

DBGET integrated database retrieval system