KEGG   Eggerthella sp. YY7918: EGYY_20910Help
Entry
EGYY_20910        CDS       T01566                                 

Gene name
AsnB
Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
eyy  Eggerthella sp. YY7918
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:eyy00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2246240..2248222
Genome map
AA seq 660 aa AA seqDB search
MCGICGFTGATDADLPILKAMCDVMAHRGPDGEGQYLDNGIALGHRRLSLIDLEGGNQPL
VRATSEHTSAVTSPALNAAGDYVQGEARGTARGDYAIVFNGEIYNYRDLRAELEADGWTF
ETHSDTEVLLVGYLAWGEGVLDKLRGMFAFAIWNRTTRELFCARDFFGIKPFYYTMQEGA
SGPRFIFASEIKCIIEHPAYQRELNEEALEQYLCFQFSALPETFFKGIMKLAPAHCMTVR
ADGSTTTRRYWRPTYHFNESRNREDTVEAIDAAMRESVRYHNVADVEVGSFLSSGIDSSY
MAACLAKENPDIKTFTVGFAEYEGERDEISWARELADELGIENNSKHISEEEYWASLPRV
QWHMDEPSADPSAVALYFVDQEAAKKVKAVLSGEGADEFFGGYRIYQTPFANQKLAWAPK
GLLRGASKAARALGVRGANYLERASETPEDWYYTNANGVAFSPEERERLRAGKRTAGVTR
PVAPQELTAPVYAEVAGLDDTTRMQYVDLYFWLVGDILLKTDKMSMAHSLESRVPFLDKQ
VFEVSATIPTRLKANDEQTKLTLREAAERAIPKDWAQKEKLGFPVPMVNWLRQERYYNRV
KEQFTSDTAARFFNTDELVKLLDEHKAGADRSRKIWIISMFLLWYQIYFIDQKVPKKPTA
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatctgcggatttaccggcgcaaccgacgccgatctgcccatcttgaaggcc
atgtgcgacgttatggcgcaccgcgggcccgacggcgaaggccagtacctcgataacggc
atcgcactggggcaccgtcgcctctcgcttatcgaccttgagggcggcaaccagccgctc
gtacgcgccaccagcgaacatacctccgccgtgacctcccccgcgctcaacgcggcgggc
gactatgtgcagggcgaggctcgcggcaccgcgcgcggcgactacgccatcgtgttcaac
ggcgagatctacaactatcgcgacctgcgcgccgagcttgaggccgacggctggaccttc
gagacgcactccgacaccgaggtgctgctcgtgggctatctggcctggggtgaaggcgtg
ctcgataagctgcgcggcatgttcgcgttcgccatttggaaccgcaccacacgcgaactt
ttctgtgcgcgcgacttcttcggcatcaagccgttctattacacgatgcaagagggcgcg
tcaggcccgcggttcattttcgcctccgagatcaagtgcattattgagcaccccgcctac
cagcgcgagctcaacgaggaagcacttgaacagtacctgtgcttccagttctcagcacta
cccgaaacgttcttcaagggcatcatgaagctcgctcctgcgcactgcatgaccgtgcgc
gccgacggctccaccaccacgcgccgctactggcgccccacctaccacttcaacgaaagc
cgcaaccgcgaggataccgtggaggccatcgacgccgccatgcgcgagagcgtgcgctac
cacaacgtggccgacgtggaggtggggtcgtttctgtcgagcggcatcgactccagctac
atggctgcatgccttgcgaaggagaacccggatatcaagacgttcaccgtaggcttcgcc
gagtacgaaggcgagcgcgacgagatttcctgggcgcgcgaactagctgatgaactgggg
attgagaacaattccaagcacatttccgaagaggaatactgggcaagcctgccgcgcgtg
cagtggcacatggacgagccctcggccgatccctccgcggtggcactctactttgtcgac
caggaggccgcgaaaaaggtgaaggcggtgctttctggtgaaggtgccgacgagttcttt
ggcggctaccgcatttaccagacgccgtttgccaaccagaagctggcgtgggccccgaag
ggcctgttacgtggcgcgtcgaaggcggcgcgtgcgctcggcgtgcgcggtgcgaactac
cttgagcgcgcgagcgaaacacccgaggattggtactacacgaatgccaacggcgtggcg
ttctcgcccgaggagcgcgaacggctgcgcgccggcaagcgcactgcaggtgtgacgcgc
ccggttgcgccgcaggaactcaccgcacccgtgtatgccgaggtcgcaggcctcgacgac
accacgcgcatgcagtacgtcgacctctacttctggctggtcggtgacatcctactgaaa
accgacaagatgtcgatggcccactcgctcgagagccgcgtgcccttcctcgacaagcag
gtgttcgaggtgtcggccaccatccccacgcgcctcaaggccaacgacgagcaaacaaaa
ctcaccctccgcgaagccgccgaacgcgccatcccaaaggactgggcgcagaaggaaaag
ctgggcttccccgtgcccatggtgaactggctgcgccaagagcgctactacaaccgggtg
aaagaacagttcacaagcgacaccgcagcccgcttcttcaacactgacgagctggtaaag
ctgctcgacgagcacaaagccggtgccgaccgcagccgcaagatctggatcatctcaatg
tttctcttgtggtaccaaatctacttcatcgaccaaaaggtcccaaagaaaccgacagcc
tag

DBGET integrated database retrieval system