KEGG   Eggerthella sp. YY7918: EGYY_21100Help
Entry
EGYY_21100        CDS       T01566                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
eyy  Eggerthella sp. YY7918
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eyy00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    EGYY_21100
Enzymes [BR:eyy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     EGYY_21100
Exosome [BR:eyy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EGYY_21100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2265373..2266866)
Genome map
AA seq 497 aa AA seqDB search
MQPSFVVALDQGTTSSRAMLIDAQGRAVDVVQNLFPQIYPQPGWVEHDPRDILSSQLGAL
TELLVSNNIAPGDIACIGITNQRETTVVWNRETGEPVANAIVWQCRRTAPLIEKLCSDPA
VAETITAKTGLVPDAYFSASKIAWILDNVEGAREAAEAGKLAFGTVDSWLIWALTQGEVH
ATDVTNASRTMLYNIHDMCWDPWLLELFDIPESMLPEVRPSSGEFGRTANAGVIPGVPIC
GVAGDQQAALFGQCCFEPGQAKNTYGTGCFLLMHTGRVACRSTNGLITTIAASAPDVEEP
EYALEGSVFMAGALMQWLRDDLGLFENVSETSAIARSIADTGGVYIVPAFTGLGAPYWDA
EARGAIYGLTRGTGRAHVIRAALESLAYQVRDLAVAMEADAGVPLSVLNVDGGASANDFL
MQFQSDILRTPLRRPQNTETTALGAAYLAGLSAGFWTDVKALCALRVDDDTYEPGMEDAR
HAHLLEGWKCAVQRTMS
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccatccttcgtcgtagcgcttgatcagggcaccacctcgtcgcgcgctatgctc
attgatgcccagggccgtgcggtcgatgtggtgcaaaatctttttccgcaaatttacccc
cagccgggatgggtggagcatgacccgcgcgatatcctatcgtcgcagctgggcgcgctt
accgagctgctggtgtcgaacaacatcgcgccgggtgacatcgcgtgcattggcattaca
aaccagcgcgaaacaacggtggtgtggaaccgcgaaacgggggagccggtagcaaatgcc
atcgtgtggcagtgtcgccgcaccgcgccgcttatcgaaaagctctgtagcgatcctgct
gtggccgaaacgattaccgccaaaaccggtctcgtacccgacgcatacttctccgccagc
aaaatagcgtggattctcgacaacgtagaaggcgcgcgcgaagcagccgaagcgggtaag
cttgcgtttggcacggttgactcgtggcttatctgggcgctcacccagggcgaggtgcac
gctaccgacgtgacgaatgccagccgcaccatgctctacaacattcacgatatgtgctgg
gatccgtggctccttgagcttttcgacatccccgaatccatgttgcccgaagtgcgtcct
tcctcgggcgaattcggtcgcaccgccaatgcgggcgtgattccgggcgtgcctatctgt
ggcgtggcgggggaccagcaggctgcgctgttcggccagtgctgcttcgagcctggccag
gcgaagaacacctacggcaccggatgctttttgctcatgcataccgggcgcgttgcctgt
cgttcgacaaacggccttatcacgacgatagcggcttctgcgcccgatgtcgaagaaccc
gaatacgcgcttgagggaagcgtgttcatggcgggcgcactcatgcagtggctgcgcgac
gacctcggtctttttgaaaacgtctccgaaacaagcgccattgcgcgcagcattgccgac
acgggcggcgtgtatattgtgcccgcgttcaccggtctgggcgcaccgtactgggatgcc
gaggcgcgcggtgccatctacggcctcacacgcggtaccggtcgtgcgcacgttattcgt
gcggcgctcgaatcgcttgcctaccaggtacgcgatttggcggtggccatggaggctgac
gcaggggtgccgctttcggtgctcaatgtggacggcggggcttcggcgaacgattttctg
atgcagttccaaagcgatattttgcgcacgccgttgcgtcgtccgcagaacaccgagacg
acggcgctcggggcggcgtatctcgctggtttgagcgcgggtttctggacggatgtcaag
gcactgtgcgcgttgcgggtcgacgacgacacgtacgaacccggtatggaagatgcgcgc
catgcgcatttgctggaaggctggaagtgcgcagtacaacgcactatgtcataa

  All links  
No link information was found.   
DBGET integrated database retrieval system