KEGG   Eggerthella sp. YY7918: EGYY_21540Help
Entry
EGYY_21540        CDS       T01566                                 

Gene name
RuvA
Definition
holliday junction resolvasome DNA-binding subunit
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
eyy  Eggerthella sp. YY7918
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:eyy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    EGYY_21540 (RuvA)
Enzymes [BR:eyy01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     EGYY_21540 (RuvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2315178..2315795)
Genome map
AA seq 205 aa AA seqDB search
MIAFLKGVLAGKTTTTAYVDVGGVGYAVGMSQSGLSKLPEAGNPVELHTYLQVREDGISL
FGFLTLEEKALFERLIGVNGVGPKVALAALSVFSPQGLVSAVSAQDVAAVQKIPGVGKKT
ASRIVLELKGSFDEGLAGLFADEAPDAILSEQVQGAREALLSMGFTSAEADVALQGAPEG
ADESVLLQYALKRLGSAGLPTVGTT
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgattgcgtttttgaagggagtgctggcgggcaagaccaccacgacagcctatgtcgac
gtgggaggcgtgggttatgcggtgggcatgtcgcaaagcggcctttccaaacttcccgag
gcgggcaatccggttgagctgcatacctatttgcaggtgcgcgaagacggaatatcgctt
ttcggctttctgacgcttgaagaaaaggcgctgttcgaacgccttatcggcgtaaacggc
gtgggtccaaaagtggcgctggcggcgctctcggtcttttcgccacaagggttggtgtcg
gcggtatcggcccaagatgttgccgcagtacaaaagattcccggcgtaggaaagaagacc
gcctcacgcatcgtgttggaactgaagggctcgttcgacgaagggcttgccggtttgttt
gccgacgaggcccctgatgcgattttgtccgaacaggtgcagggggcgcgtgaagcgttg
ctctcgatgggtttcacatcggccgaggctgatgtcgccctccaaggagcacctgaaggt
gcggacgaaagcgtcctgttacaatatgcgttgaaacgactaggttccgccggtttgccg
accgtcggaacgacttga

DBGET integrated database retrieval system