KEGG   Eggerthella sp. YY7918: EGYY_22440Help
Entry
EGYY_22440        CDS       T01566                                 

Definition
(RefSeq) hypothetical protein
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
eyy  Eggerthella sp. YY7918
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:eyy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    EGYY_22440
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EGYY_22440
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    EGYY_22440
Enzymes [BR:eyy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     EGYY_22440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2398899..2400443
Genome map
AA seq 514 aa AA seqDB search
MGRNYYIDTRGRGEHPVTFTEAVINGLATGGGLYVPEHIPALTLDEIAELAQLPYAQRAA
RIYQAFDIDLPADTIEALMAQTYGDNFDDERICPITTLNANTHVLELWHGPTSAFKDMAL
QCLPRFFSASAKQLREQGKLDHDFMILVATSGDTGKAALEGFCDAEGVSIGVMYPDGGVS
DIQFKQMATQRGENVQVWGVRGNFDDCQTGAKNVFGDEAFAERLLKEHHVALSSANSINW
GRLMPQIVYYVSAYAQLVADGKLGPGDELDVCVPTGNFGNILAAYYAKRMGTPLGMLFCA
SNENRVLTDFINTGTYDIAERDFVLTPSPSMDILVSSNLERQLFELTGRNAEAIAGWMDD
LREQRRFRVDETTFAKVREQFVADSIDNATCLATIKAVFDEHGYLLDPHTAVAYQTAENL
RGENPVLVASTAHWAKFGDNVYRALHDLEPGAPLPADVAALSGCELNELIARETGRRDIP
RGLAELDTLPIRFDEVIDGGTDDIEKAVTRFLAN
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgggccgtaattactacatcgacacgcggggacgcggcgagcaccccgtcacatttacc
gaagccgtcatcaacggactggccacaggcggcggactgtacgtgcccgagcatatcccc
gcgctcacactcgacgagattgccgagctggcgcagctgccctacgcccagcgcgcggcg
cgcatctatcaagcgtttgacatcgacctgcccgccgacaccatcgaagcgctcatggcg
cagacgtacggcgacaacttcgacgacgagcgcatctgccctatcaccacactcaacgcg
aacacccacgtgctggagctgtggcatggccctacgagcgcgttcaaagacatggcgctg
cagtgtctaccgcgcttcttctccgccagtgccaaacagttgcgcgaacaggggaaactc
gaccacgacttcatgatcctcgtagccacctccggtgacaccggcaaggcggcgcttgag
ggcttttgcgacgccgagggcgtgtccattggtgtgatgtaccccgatggcggcgtgagc
gacattcagttcaagcagatggccacccaacgcggcgagaacgtgcaggtgtggggcgtg
cgcggcaacttcgacgactgccagacgggcgcgaaaaacgtgtttggtgacgaagcgttc
gccgagcgactgctgaaagaacaccacgtggcgctttccagcgcgaactccatcaactgg
ggacgcctcatgcctcagatcgtgtactacgtgtcggcctacgcgcagctggtggccgac
ggcaagctgggcccgggcgatgagctggacgtatgcgtgcctacgggcaactttggcaac
atcctggccgcctactacgccaagcgcatgggcaccccgctcggtatgctcttctgcgcg
agcaacgaaaaccgcgtgctcaccgacttcatcaacacgggcacctatgacatcgccgag
cgcgatttcgtgctgacaccgtcgccttccatggacatcctcgtgtcgtcgaaccttgag
cgccagctgttcgagctcaccggtcgcaacgcggaagccatcgccggttggatggatgac
ctgcgcgaacagcgccgcttccgcgtggacgagaccaccttcgcgaaagtgcgcgagcag
ttcgtggccgactccatcgacaatgccacgtgcttggccaccatcaaagccgtgttcgac
gagcatggttacttgctggacccgcacacggccgtggcctaccagaccgccgagaacctg
cgcggcgagaaccccgtcctcgtagccagcacggcccattgggcgaagttcggcgacaac
gtgtaccgcgcgctgcacgacctggagccgggcgccccgctgcccgccgacgtggccgca
ctttcaggctgcgagctgaacgaacttatcgcacgcgaaacaggccgccgcgacatcccg
cgcggtctggccgagctggacacgctacccatccgcttcgatgaggttatcgatggcggc
actgatgacatcgagaaggcagtgacacgcttcttggcgaactga

DBGET integrated database retrieval system