KEGG   Eggerthella sp. YY7918: EGYY_23120Help
Entry
EGYY_23120        CDS       T01566                                 

Gene name
PorB
Definition
(GenBank) pyruvate:ferredoxin oxidoreductase
  KO
K00170  
pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
eyy  Eggerthella sp. YY7918
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:eyy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EGYY_23120 (PorB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EGYY_23120 (PorB)
   00020 Citrate cycle (TCA cycle)
    EGYY_23120 (PorB)
   00620 Pyruvate metabolism
    EGYY_23120 (PorB)
   00640 Propanoate metabolism
    EGYY_23120 (PorB)
   00650 Butanoate metabolism
    EGYY_23120 (PorB)
  Energy metabolism
   00680 Methane metabolism
    EGYY_23120 (PorB)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    EGYY_23120 (PorB)
Enzymes [BR:eyy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     EGYY_23120 (PorB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2478079..2478993)
Genome map
AA seq 304 aa AA seqDB search
MNVKTISDDEFFFGHKACAGCGGSLAVRAALKVLGPNAVAALPAGCMSAVGFNFPQLAFA
NNAMITPFAATASVLTGIEVGLRAQGKKPDDCTVVGFAGDGGTADIGLQALSGAIDRNDD
VLYICYDNEAYMNTGIQKSSLTPFGAKTTTTPAGSNVHGCLTQKKNLFEIVAAHGIPYAA
TASIGYLNDFIRKVERARDIHGTRYIHVMAPCPTGWGCGVDETVDIAKDIVDTGLWYLAE
YEGEQVSGQPGGRFKLNRNPRKFASVEAYLRRQGRFRALTDEEVAAVEAGRDVAWEVMRR
DWLS
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtaaaaaccatctctgacgacgagtttttcttcggtcacaaggcgtgcgccggg
tgcggcggatcgcttgctgtgcgcgctgcgctcaaggtgctcgggccgaacgcggtggcc
gctctgcctgcaggttgcatgagtgctgtcggcttcaattttccgcagcttgcttttgcc
aataatgcaatgatcacgccttttgccgctacggcgagcgtgcttaccggcattgaagta
ggtttgcgtgctcaagggaaaaagccggatgactgtaccgtggtgggttttgccggcgac
ggcggaacggccgacatcgggctgcaggcgctctccggcgcaattgaccgcaacgatgac
gtgctctacatctgctatgacaatgaagcgtacatgaacacgggcatccagaagagctca
ctcacgccgtttggtgccaagaccaccacaacccccgccgggagcaacgtccacggttgc
cttacgcagaagaagaatctgtttgaaattgtggctgctcacggcatcccctatgccgcc
accgcgtccattggttatttgaacgacttcatccgaaaggtggagcgggcccgcgatatc
catggcacgcgctacatccatgtgatggctccgtgtccgaccggctggggatgcggcgtg
gacgagacggtggacattgccaaggatatcgtcgacacgggtttgtggtacctcgctgaa
tacgagggagagcaggtgtccggccagcccggaggccgtttcaaactcaaccgtaacccg
cgaaagttcgccagtgtcgaggcctatctgcgtcgtcaaggtcgcttccgtgcgctcact
gacgaagaggttgccgccgtagaagctggtcgcgacgttgcctgggaagtcatgcgaagg
gactggctgagctaa

DBGET integrated database retrieval system