KEGG   Eggerthella sp. YY7918: EGYY_23130Help
Entry
EGYY_23130        CDS       T01566                                 

Gene name
PorA
Definition
pyruvate:ferredoxin oxidoreductase
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
eyy  Eggerthella sp. YY7918
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eyy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EGYY_23130 (PorA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EGYY_23130 (PorA)
   00020 Citrate cycle (TCA cycle)
    EGYY_23130 (PorA)
   00620 Pyruvate metabolism
    EGYY_23130 (PorA)
   00640 Propanoate metabolism
    EGYY_23130 (PorA)
   00650 Butanoate metabolism
    EGYY_23130 (PorA)
  Energy metabolism
   00680 Methane metabolism
    EGYY_23130 (PorA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    EGYY_23130 (PorA)
Enzymes [BR:eyy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     EGYY_23130 (PorA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2478994..2480202)
Genome map
AA seq 402 aa AA seqDB search
MKRFLSGDEALAEGVRLARPQVISAYPITPQTVVVERLSEMVESGELAAEYVHVESEHSA
LSCAIGASATGARTFTATSSQGLLYMAECLTYASGGRFPIVMMNANRATALPWNIYGDQR
DSLALLDHGWIQVYAEDNQEALDLALMAYALAEDARIMTPVMVNLDGFALTHTYETVDVP
SPAQADAFLPPYSTASNRFDFEHPVNIGYSAGPEYNRYYKYWEHRDMLDVPKVVDEIEQK
FAEVFGRRYSGMIECVECDDAEVILVTLGSTAGLARSVVKELRAQGVRAGLLRIRYLRPM
PSALIAEALRGAKAVAVLEQDISFGAEGTVFTNVNSVLQQAGVGVPTYNFIGGLGGDDIS
EAHVFGVYETLLQAAAGTSDISRVSFLGIDSPAVPPFGRTEE
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggtttctttctggtgacgaagctcttgctgagggtgtgcgccttgcgcggccg
caggttatttccgcatatcccattacgccgcaaaccgttgtggttgagcgtctaagcgaa
atggtggagtccggcgaactggcagccgaatacgtgcatgtggaaagcgagcattcggcg
ctttcgtgtgcgattggcgcgtcggcgacgggcgcacgcacgttcacggccacatcgagt
caaggccttctctatatggccgagtgtttgacgtatgcatcgggcggacgattccccatt
gtcatgatgaacgcgaaccgcgcaaccgcgctgccttggaatatctacggcgatcagcgc
gattcgctcgcgcttttggaccacggctggattcaggtatacgccgaagataatcaggag
gcgcttgacctggcgcttatggcgtatgcgctggctgaagatgcgcgtatcatgacgcct
gtgatggtgaaccttgatggatttgcactcacgcatacctacgagacggtggacgtaccc
tcgcctgcacaggccgacgcgtttttgccgccttatagcactgcgagtaaccgtttcgat
ttcgagcatccggtaaacatcggctattcggcaggacccgaatacaatcggtattacaag
tactgggaacatcgcgacatgctggatgtgccgaaggtggtcgacgagatcgagcagaag
tttgcagaggtcttcggccgccgctattccggcatgattgagtgcgtggagtgcgacgat
gccgaggtcattttggtgacgcttggctcgacggcggggcttgcacgcagtgtggtgaag
gaactacgtgcacaaggtgttcgtgcgggacttttgcgtatacgctacttgcgtcccatg
ccaagtgcccttattgccgaagctttgcgtggcgcgaaagcggtggccgtgctggaacaa
gatatctcgtttggcgcggaaggtacggtgtttaccaacgtcaactccgtattgcagcaa
gcgggcgtgggcgtgccgacctataactttatcggaggtctcggcggcgacgatatctcc
gaagcgcatgtttttggggtgtacgagacacttctacaggcagctgcgggaacgagcgat
atttcgcgcgtgtcgttccttggcatcgattcaccggcggttcctccgttcggcagaacg
gaggaataa

DBGET integrated database retrieval system