KEGG   Eggerthella sp. YY7918: EGYY_23130Help
Entry
EGYY_23130        CDS       T01566                                 

Gene name
PorA
Definition
pyruvate:ferredoxin oxidoreductase
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
eyy  Eggerthella sp. YY7918
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:eyy01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:eyy00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:eyy00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:eyy00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:eyy00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:eyy00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:eyy00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:eyy00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2478994..2480202)
Genome map
AA seq 402 aa AA seqDB search
MKRFLSGDEALAEGVRLARPQVISAYPITPQTVVVERLSEMVESGELAAEYVHVESEHSA
LSCAIGASATGARTFTATSSQGLLYMAECLTYASGGRFPIVMMNANRATALPWNIYGDQR
DSLALLDHGWIQVYAEDNQEALDLALMAYALAEDARIMTPVMVNLDGFALTHTYETVDVP
SPAQADAFLPPYSTASNRFDFEHPVNIGYSAGPEYNRYYKYWEHRDMLDVPKVVDEIEQK
FAEVFGRRYSGMIECVECDDAEVILVTLGSTAGLARSVVKELRAQGVRAGLLRIRYLRPM
PSALIAEALRGAKAVAVLEQDISFGAEGTVFTNVNSVLQQAGVGVPTYNFIGGLGGDDIS
EAHVFGVYETLLQAAAGTSDISRVSFLGIDSPAVPPFGRTEE
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggtttctttctggtgacgaagctcttgctgagggtgtgcgccttgcgcggccg
caggttatttccgcatatcccattacgccgcaaaccgttgtggttgagcgtctaagcgaa
atggtggagtccggcgaactggcagccgaatacgtgcatgtggaaagcgagcattcggcg
ctttcgtgtgcgattggcgcgtcggcgacgggcgcacgcacgttcacggccacatcgagt
caaggccttctctatatggccgagtgtttgacgtatgcatcgggcggacgattccccatt
gtcatgatgaacgcgaaccgcgcaaccgcgctgccttggaatatctacggcgatcagcgc
gattcgctcgcgcttttggaccacggctggattcaggtatacgccgaagataatcaggag
gcgcttgacctggcgcttatggcgtatgcgctggctgaagatgcgcgtatcatgacgcct
gtgatggtgaaccttgatggatttgcactcacgcatacctacgagacggtggacgtaccc
tcgcctgcacaggccgacgcgtttttgccgccttatagcactgcgagtaaccgtttcgat
ttcgagcatccggtaaacatcggctattcggcaggacccgaatacaatcggtattacaag
tactgggaacatcgcgacatgctggatgtgccgaaggtggtcgacgagatcgagcagaag
tttgcagaggtcttcggccgccgctattccggcatgattgagtgcgtggagtgcgacgat
gccgaggtcattttggtgacgcttggctcgacggcggggcttgcacgcagtgtggtgaag
gaactacgtgcacaaggtgttcgtgcgggacttttgcgtatacgctacttgcgtcccatg
ccaagtgcccttattgccgaagctttgcgtggcgcgaaagcggtggccgtgctggaacaa
gatatctcgtttggcgcggaaggtacggtgtttaccaacgtcaactccgtattgcagcaa
gcgggcgtgggcgtgccgacctataactttatcggaggtctcggcggcgacgatatctcc
gaagcgcatgtttttggggtgtacgagacacttctacaggcagctgcgggaacgagcgat
atttcgcgcgtgtcgttccttggcatcgattcaccggcggttcctccgttcggcagaacg
gaggaataa

DBGET integrated database retrieval system