KEGG   Eggerthella sp. YY7918: EGYY_23140Help
Entry
EGYY_23140        CDS       T01566                                 

Gene name
PorG
Definition
(GenBank) pyruvate:ferredoxin oxidoreductase
  KO
K00172  
pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
eyy  Eggerthella sp. YY7918
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:eyy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EGYY_23140 (PorG)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EGYY_23140 (PorG)
   00020 Citrate cycle (TCA cycle)
    EGYY_23140 (PorG)
   00620 Pyruvate metabolism
    EGYY_23140 (PorG)
   00640 Propanoate metabolism
    EGYY_23140 (PorG)
   00650 Butanoate metabolism
    EGYY_23140 (PorG)
  Energy metabolism
   00680 Methane metabolism
    EGYY_23140 (PorG)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    EGYY_23140 (PorG)
Enzymes [BR:eyy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     EGYY_23140 (PorG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2480199..2481320)
Genome map
AA seq 373 aa AA seqDB search
MIEVLWHGRGGQGAFTAARLLGAAASLADGRYALAFPSFGPERRGAPMRAFTKLSDVPIG
DRSAITQADYVIYLDDTLLGEGWEDELKPGGVVLINSVQTFDDDRILAIDADGISADILG
RPIPNTVFLGALSALCDQVKREDVQEAIRQYMPEKLHAKNSAIVDAAFHQVVECVDETVS
AAHHPVQSVSAPSCPERSAQREVEGPRAATAEARTVGTVGDPSTPHLRCSAQDDKPVRPS
VHIPTLRTDELDPTSYARTTCFEAGYLVAKNAGWRNIRPVVDLSACTGCLQCYLYCPDGT
IYKVPSACQSAETLADVIQPARNQTFVAIDYDFCKGCGICARMCKFGAIAMISEKEALAA
ETAGDLESEASAR
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgattgaagttttatggcatggccgcggcggccaaggggcatttacggcggcgcggctc
ttgggcgcagcggcctcgcttgcagatggccgctatgcgcttgcctttccctcgttcggg
ccggagcgtcgcggcgcgcctatgcgagcgttcacgaagttgtccgacgtgcccatcggc
gatagaagcgctattacgcaggccgactacgtgatctatcttgacgacacgcttttgggc
gaaggctgggaagatgaacttaagcccggcggggtggtgctcatcaacagtgtacagacc
tttgatgacgatcgtatcttggccattgatgccgatggtatctcggcagatattttgggt
cgacccattcccaacacggtgtttttgggtgcgctctcggcgctgtgcgaccaggtgaag
cgcgaggatgtacaagaggccattcgccagtacatgcccgaaaagttgcacgcgaagaat
agtgccatagtggatgcggcttttcaccaggttgtggaatgtgttgacgaaacggtttct
gccgcgcaccatcccgtgcaaagcgtcagcgccccttcctgtcccgagcgtagcgcgcag
cgcgaagtcgagggaccccgtgcggcgacagctgaagcacgtacggttggtaccgtaggg
gatccttcgactccgcaccttcggtgctccgctcaggatgacaaacccgttcggccttcc
gttcacattcccacgttgcgtacagacgagcttgacccgaccagttacgcgcgtacgacg
tgttttgaggcggggtatttggtggcgaaaaacgctggctggcgcaatatccgccctgtt
gttgacctctccgcttgcaccggttgtctgcagtgttatctctactgtccggatggcacc
atatataaggttccgtcggcttgtcagtcggcggaaaccctcgctgatgttattcaaccg
gcgaggaaccaaacttttgttgccatcgactacgatttttgcaaaggctgcggcatttgc
gcgcggatgtgcaagttcggtgccatcgcgatgatttccgaaaaagaagcactcgctgcc
gagactgcgggcgatctggaaagtgaggcgagtgcccgatga

DBGET integrated database retrieval system