KEGG   Eggerthella sp. YY7918: EGYY_27080Help
Entry
EGYY_27080        CDS       T01566                                 

Gene name
FolE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
eyy  Eggerthella sp. YY7918
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eyy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EGYY_27080 (FolE)
Enzymes [BR:eyy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     EGYY_27080 (FolE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2828335..2828904)
Genome map
AA seq 189 aa AA seqDB search
MDKAKIEEGVRMILEGVGEDPTREGLRETPARVARMYEEVFAGLEQDPAEHFATTFDEHH
EEMVLVRDIPFYSMCEHHLVPFFGMAHVAYIPAADGRICGLSKLARLVDVFAKRPQVQER
LTSQIADTLIDELHPQGVIVVLEAEHLCMSMRGVKKAGAKTTTSAVRGAFERSQATRAEA
LSLIFARRD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggacaaggcaaaaatcgaagagggcgtgcggatgatccttgaaggcgtgggggaggat
cccacgcgcgaagggctgcgcgaaacgccggcgcgtgtggcgcgcatgtacgaagaagtg
tttgcgggacttgagcaagatccggccgagcactttgccaccacattcgacgagcatcac
gaggaaatggtgctcgtgcgcgacatccccttttactccatgtgcgagcatcatctcgta
ccgtttttcggcatggcgcatgtggcctatattccggcggccgacgggcgcatttgcggt
ctgtcgaaactcgcacggctggtggatgtgttcgcgaagcgtccgcaggtgcaggagcgt
ttgacctcgcaaatcgccgacacgcttatcgacgagctgcatccccagggtgtcattgtg
gtgttggaggccgagcatctttgcatgagcatgcgcggcgtaaagaaggcgggcgcgaaa
accaccacgagcgccgttcgcggcgcgttcgaacgcagccaagccacccgtgccgaagcc
ctctccctcatcttcgctcgacgggactaa

DBGET integrated database retrieval system