KEGG   Eggerthella sp. YY7918: EGYY_27490Help
Entry
EGYY_27490        CDS       T01566                                 

Gene name
IspE
Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate synthase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
eyy  Eggerthella sp. YY7918
Pathway
eyy00900  Terpenoid backbone biosynthesis
eyy01100  Metabolic pathways
eyy01110  Biosynthesis of secondary metabolites
eyy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:eyy00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EGYY_27490 (IspE)
Enzymes [BR:eyy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     EGYY_27490 (IspE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C AAA_25
Motif
Other DBs
NCBI-ProteinID: BAK45744
UniProt: F7UX27
Position
complement(2871750..2872709)
Genome map
AA seq 319 aa AA seqDB search
MLATAHAAQGDDTRVFRSGAIKLIAPAKVNLYLDIGDVRPDGYHNATTIMHALTLHDVLY
MKRIPEQGKGLSIDLTCAAFEGTAPLDVEPEHNIVSKAIRALAKRMGRICDETLVVRLEK
HIPSQAGLGGGSSNAAAALVGAAHLWGLAPDDARIEDVARTLGADVAFFLHGGCACFTGV
GEDFLHELRPMGLPVVVVKPEGGVSTAEAYRTFDAHPEYIDAADRETALAARCAQEVPLR
NNLEGASELLMPELADIRTWLSAHEGVEDVLMSGSGSAIFARCSTLETTHRIAAAAQACG
WWARATTFGPVRAAIVPRS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgttggcgaccgcgcatgccgcgcaaggtgatgacacccgcgttttcaggagcggcgcg
ataaaacttatcgcaccggccaaggtcaacctatacctcgacatcggcgatgtgcgaccc
gacggataccacaatgccactaccatcatgcacgcgcttaccctgcatgatgtgctgtat
atgaaacggattccggaacaggggaaagggttgagcatcgacctgacctgcgccgccttt
gaaggaaccgcaccgcttgacgttgaacccgagcataacattgtcagcaaggcaattcgt
gcgcttgccaagcgcatggggcgtatctgtgacgaaacgctggtcgtgcgcctggaaaag
cacattccttcccaagcgggccttggcgggggttcgtcgaacgcggcagcggcgctcgtg
ggcgctgcgcatctttgggggcttgcgcccgacgatgcgcgcatcgaggatgtggcccgt
acactcggggctgacgtggcgtttttcctgcacggcggttgcgcgtgctttaccggcgtg
ggcgaggacttccttcacgagctgcgtccgatgggcttgccggtcgtcgtggtcaaaccc
gaaggcggcgtgtcgacggcggaagcctatcgtacgttcgacgcgcatcccgaatacatc
gatgccgcagatcgcgaaaccgcgcttgccgcacgctgtgcgcaggaggttccgttgcgc
aacaacctggaaggtgcttctgagttgctcatgcccgaattggccgatataagaacgtgg
ctttccgcgcatgaaggcgtagaggatgttctcatgtcgggaagcggatcggcgatcttt
gcccgatgcagcacccttgagaccacacaccgcattgctgctgcggcgcaagcgtgcggc
tggtgggcgcgggctaccaccttcggtcctgttcgcgcggcgattgttcctcgttcgtga

DBGET integrated database retrieval system