KEGG   Eggerthella sp. YY7918: EGYY_27490Help
Entry
EGYY_27490        CDS       T01566                                 

Gene name
IspE
Definition
4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate synthase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
eyy  Eggerthella sp. YY7918
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eyy00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EGYY_27490 (IspE)
Enzymes [BR:eyy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     EGYY_27490 (IspE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2871750..2872709)
Genome map
AA seq 319 aa AA seqDB search
MLATAHAAQGDDTRVFRSGAIKLIAPAKVNLYLDIGDVRPDGYHNATTIMHALTLHDVLY
MKRIPEQGKGLSIDLTCAAFEGTAPLDVEPEHNIVSKAIRALAKRMGRICDETLVVRLEK
HIPSQAGLGGGSSNAAAALVGAAHLWGLAPDDARIEDVARTLGADVAFFLHGGCACFTGV
GEDFLHELRPMGLPVVVVKPEGGVSTAEAYRTFDAHPEYIDAADRETALAARCAQEVPLR
NNLEGASELLMPELADIRTWLSAHEGVEDVLMSGSGSAIFARCSTLETTHRIAAAAQACG
WWARATTFGPVRAAIVPRS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgttggcgaccgcgcatgccgcgcaaggtgatgacacccgcgttttcaggagcggcgcg
ataaaacttatcgcaccggccaaggtcaacctatacctcgacatcggcgatgtgcgaccc
gacggataccacaatgccactaccatcatgcacgcgcttaccctgcatgatgtgctgtat
atgaaacggattccggaacaggggaaagggttgagcatcgacctgacctgcgccgccttt
gaaggaaccgcaccgcttgacgttgaacccgagcataacattgtcagcaaggcaattcgt
gcgcttgccaagcgcatggggcgtatctgtgacgaaacgctggtcgtgcgcctggaaaag
cacattccttcccaagcgggccttggcgggggttcgtcgaacgcggcagcggcgctcgtg
ggcgctgcgcatctttgggggcttgcgcccgacgatgcgcgcatcgaggatgtggcccgt
acactcggggctgacgtggcgtttttcctgcacggcggttgcgcgtgctttaccggcgtg
ggcgaggacttccttcacgagctgcgtccgatgggcttgccggtcgtcgtggtcaaaccc
gaaggcggcgtgtcgacggcggaagcctatcgtacgttcgacgcgcatcccgaatacatc
gatgccgcagatcgcgaaaccgcgcttgccgcacgctgtgcgcaggaggttccgttgcgc
aacaacctggaaggtgcttctgagttgctcatgcccgaattggccgatataagaacgtgg
ctttccgcgcatgaaggcgtagaggatgttctcatgtcgggaagcggatcggcgatcttt
gcccgatgcagcacccttgagaccacacaccgcattgctgctgcggcgcaagcgtgcggc
tggtgggcgcgggctaccaccttcggtcctgttcgcgcggcgattgttcctcgttcgtga

DBGET integrated database retrieval system