KEGG   Eggerthella sp. YY7918: EGYY_30010Help
Entry
EGYY_30010        CDS       T01566                                 

Gene name
DdlA
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
eyy  Eggerthella sp. YY7918
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:eyy00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    EGYY_30010 (DdlA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EGYY_30010 (DdlA)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    EGYY_30010 (DdlA)
Enzymes [BR:eyy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     EGYY_30010 (DdlA)
Peptidoglycan biosynthesis and degradation proteins [BR:eyy01011]
 Precursor biosynthesis
  Amino acid ligase
   EGYY_30010 (DdlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3113946..3114884)
Genome map
AA seq 312 aa AA seqDB search
MSVFDPHEYRVALLAGGTSGEREVSLASGEGAQAALKEAGFEVCMLDPANKEDLKRLIDE
PFDVAFLCLHGKCGEDGTVQGFLEVVGIPYIGSGVWSSALAMDKVKAKLFYERANLPTPP
SVTVIAGDMIDGDNIVAALGERCVVKPATEGSALGVFIVEGPHDVEEAISKALEIDNEVV
VERFIKGTELTVAVLGDDVLEALPVIEIVPSNDFYDYESKYAPGGSKHICPAPLSEKMTE
RVQDLAVCAHRALSCRGVSRSDLILEDDGSCWILETNTIPGMTGTSLLPDAARAAGISFP
ELCTRLIKMALS
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtcttcgatcctcatgagtatcgtgtggcgttgcttgcgggaggcacaagtggc
gaacgtgaagtatctttagcatctggagaaggcgcacaggctgctcttaaagaagctggt
ttcgaggtatgtatgcttgatccagcaaataaggaagatttgaagcgtttaatcgatgag
ccattcgacgttgcgtttctctgcttgcacggtaaatgtggcgaagatggaaccgtacaa
gggtttcttgaggtagttggcattccgtatattggttcgggagtatggtcgagtgcgctg
gctatggataaggtgaaggctaagttgttctatgaacgggcgaacttgccgacaccgccg
tcggtcaccgtgattgctggtgatatgatcgacggggataatattgttgctgcgttgggt
gaacgctgcgttgtgaagccggctactgaaggtagcgctttaggggtgtttattgttgaa
gggccgcacgacgtcgaagaagctattagcaaagcacttgagattgataatgaagtggtc
gtcgaacgtttcataaaagggacggagcttactgttgctgtactgggcgacgatgtgtta
gaggcccttcctgtcattgaaatagtaccttccaatgatttttatgactatgaatcgaaa
tacgctcctggcgggtctaagcatatttgtccggcgccgttgagcgaaaagatgacagaa
cgcgttcaggatctcgcggtgtgcgctcatcgggcgctatcctgtcgaggcgtttctcgc
tcggatctgattttagaagatgatggctcgtgttggattcttgaaaccaacaccataccg
ggcatgacggggacttccttgcttcctgatgccgctcgtgctgcaggaatttcatttcca
gagctttgcacacgccttatcaagatggcacttagctaa

DBGET integrated database retrieval system