KEGG   Filifactor alocis: HMPREF0389_00062Help
Entry
HMPREF0389_00062  CDS       T01663                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
faa  Filifactor alocis
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:faa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HMPREF0389_00062
Enzymes [BR:faa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     HMPREF0389_00062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(646875..647513)
Genome map
AA seq 212 aa AA seqDB search
MKKKGLLIVLSGPSGSGKGTICKRFLEKNEKVGLSISATTRAPRDGEVDGTHYFFIDKPK
FEEMIEKQELLEYVHVFDNYYGTPKKYVEDKIESGDDVILEIEIEGAMNIKASYPDAVLI
FVLPPTIEELKRRICSRGTETMEQIDKRLDRSIREISEIEQYSYFIVNDDLEYSVKELEA
IVLAEKNRVSRYTKQIHELYQDYENGMKEYSK
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaaaggactgttgattgtgctttcgggaccatccggaagcggaaaaggaacg
atttgtaaaaggtttttggagaaaaatgaaaaagtaggactttctatttcggcaacaacg
agagctccaagggatggagaggtagacggaacacattatttttttatagataagcccaaa
tttgaagaaatgattgagaaacaggaacttttggaatatgttcatgtattcgataactat
tacggcactcctaaaaagtatgtggaagataaaattgaatccggagatgatgttatttta
gaaattgagattgagggagcaatgaatatcaaagcaagttatccggatgcagttcttatt
tttgtattgccaccgacgattgaagaattgaagagaagaatttgtagtcgtggaacagaa
actatggagcagatagataagaggttagatcgttccattcgtgaaatcagtgaaattgaa
cagtattcatattttattgtgaatgatgatttggaatactccgtaaaagagttggaagca
attgttttggcagaaaaaaacagggtttccagatatacgaaacagattcatgaactttat
caagattatgaaaatgggatgaaggaatattcgaaatag

DBGET integrated database retrieval system