KEGG   Filifactor alocis: HMPREF0389_00075Help
Entry
HMPREF0389_00075  CDS       T01663                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
faa  Filifactor alocis
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:faa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF0389_00075
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HMPREF0389_00075
Enzymes [BR:faa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     HMPREF0389_00075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(633491..634780)
Genome map
AA seq 429 aa AA seqDB search
MKGMDSLAYITVKESPSLRGTVQISGAKNAVLPIIAATLLAEGISVIKGVPNLKDVQVMV
ELLACLGAKAELKGDSLFVDASHITSVEAPHELVNKMRASFLVMGALLSRFQRAKISLPG
GCAIGSRPIDLHLKGFEALGATVNIIDEGLQSGYIEAHAKEYLQGGKVYLDFPSVGATEN
ILMAASLTPGVTVIENAAEEPEIVDLANYLNNMGARVRGAGTNTIRIIGVEKLHPIEYTV
IPDRIEAGTFMVAAAMTKGDVLVENVITDHIKPVIAKLTEIGCTIEEYDNAVRVIGPEVI
KSATIKTMPHPGFPTDLQSLFMALLCIAEGESTVTETVFENRFMNVPELIRMGADIEING
ETAIVNGVSKLYGSEVVATDLRAGAALIISGLVAEGATKIRNIYHIDRGYVDIVGKLSKL
GANISRVED
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaagggaatggattcgttggcgtatattacagtaaaagaaagtcctagtttaagaggg
actgttcaaataagtggtgcaaaaaatgctgtattgccgattattgcggcaacattattg
gcagagggcatttctgttattaaaggagttcctaatttgaaggatgtgcaagttatggtg
gagttattggcttgcttgggagcaaaagcggaattaaaaggggattcgctttttgtagat
gcttctcatattacttctgtggaagctccgcatgaacttgttaataagatgagagcttct
tttttggtgatgggagcactgttatccagatttcaaagagcaaaaatttctttgcccggt
ggatgtgcgattggaagcagaccgatagatttgcacttaaaaggatttgaggcgctggga
gcaacggttaatatcatagacgaagggcttcagtcaggatatatcgaagcgcatgctaag
gaatatttacagggtggaaaggtgtatttggattttccttctgtaggagcaactgaaaat
attttgatggcggcttctttgactccaggagtaacagtcattgaaaatgctgctgaagaa
cctgaaattgttgatttggcaaattatttaaataatatgggagcaagggtcagaggtgca
ggaacaaataccattcgtatcataggtgtagaaaaacttcatccgattgagtatacagta
attccagacagaattgaagcgggtacattcatggttgcggcagcgatgacaaaaggagat
gtgttggttgaaaatgttatcactgaccatattaagcctgttattgcaaaattgactgag
attggatgtacaatagaagagtatgataatgcggttcgggtgattggacctgaggttata
aaaagtgcaacgattaaaacgatgcctcatcccggatttccgacagatttacagtcttta
tttatggctttgctctgcatagcagaaggagaatctactgtgacagagacagtgttcgaa
aaccgttttatgaatgttcccgaattgattcgaatgggagcggatattgagattaacgga
gaaacagcgattgtaaacggtgtttccaagttgtatggtagtgaagttgttgcgacagac
ttaagagcgggagctgctttgattatcagtggtctggtagcagaaggagctacaaaaatc
agaaatatttatcatattgacagagggtatgtagatatcgttgggaaattgtcaaaattg
ggagcgaatatcagtcgagtagaggattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system